Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NVQ4

- FAIM1_HUMAN

UniProt

Q9NVQ4 - FAIM1_HUMAN

Protein

Fas apoptotic inhibitory molecule 1

Gene

FAIM

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.By similarity

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. negative regulation of apoptotic process Source: InterPro
    3. negative regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: Ensembl

    Keywords - Biological processi

    Apoptosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fas apoptotic inhibitory molecule 1
    Gene namesi
    Name:FAIM
    Synonyms:FAIM1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:18703. FAIM.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38647.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 179178Fas apoptotic inhibitory molecule 1PRO_0000087173Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylthreonine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9NVQ4.
    PaxDbiQ9NVQ4.
    PRIDEiQ9NVQ4.

    PTM databases

    PhosphoSiteiQ9NVQ4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NVQ4.
    BgeeiQ9NVQ4.
    CleanExiHS_FAIM.
    GenevestigatoriQ9NVQ4.

    Organism-specific databases

    HPAiHPA042440.
    HPA052209.

    Interactioni

    Protein-protein interaction databases

    BioGridi120478. 2 interactions.

    Structurei

    Secondary structure

    1
    179
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi4 – 129
    Beta strandi15 – 239
    Turni25 – 273
    Beta strandi30 – 345
    Beta strandi37 – 426
    Beta strandi50 – 567
    Turni57 – 604
    Beta strandi61 – 7010
    Turni71 – 733
    Beta strandi74 – 818
    Beta strandi84 – 885
    Beta strandi98 – 1047
    Beta strandi107 – 1148
    Turni115 – 1184
    Beta strandi119 – 1224
    Beta strandi125 – 1273
    Beta strandi130 – 1345
    Beta strandi137 – 1448
    Beta strandi147 – 1548
    Beta strandi157 – 1604
    Beta strandi164 – 1696
    Beta strandi172 – 1743

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2KW1NMR-A91-179[»]
    3MX7X-ray1.76A1-90[»]
    ProteinModelPortaliQ9NVQ4.
    SMRiQ9NVQ4. Positions 1-179.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the FAIM1 family.Curated

    Phylogenomic databases

    eggNOGiNOG296668.
    HOGENOMiHOG000007913.
    HOVERGENiHBG051543.
    InParanoidiQ9NVQ4.
    OMAiAISGFAY.
    OrthoDBiEOG7R56TX.
    PhylomeDBiQ9NVQ4.
    TreeFamiTF314971.

    Family and domain databases

    InterProiIPR010695. FAIM.
    [Graphical view]
    PANTHERiPTHR13088. PTHR13088. 1 hit.
    PfamiPF06905. FAIM1. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to Basket

    Also known as: FAIM-S

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG    50
    KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW 100
    VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY 150
    IKAVSSGKRK EGIIHTLIVD NREIPEIAS 179
    Length:179
    Mass (Da):20,215
    Last modified:October 1, 2000 - v1
    Checksum:i129E7E4525535C72
    GO
    Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

    Show »
    Length:213
    Mass (Da):24,041
    Checksum:iF4350AA22E14A727
    GO
    Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to Basket

    Also known as: FAIM-L

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MASGDDSPIFEDDESPPYSLEKM

    Show »
    Length:201
    Mass (Da):22,626
    Checksum:i785BB238F63F4568
    GO

    Sequence cautioni

    The sequence BAC86174.1 differs from that shown. Reason: Intron retention.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti32 – 321V → L in BQ638715. (PubMed:12107411)Curated
    Sequence conflicti66 – 661N → S in CAG33403. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti117 – 1171A → T.2 Publications
    Corresponds to variant rs641320 [ dbSNP | Ensembl ].
    VAR_024314
    Natural varianti127 – 1271L → S.1 Publication
    Corresponds to variant rs13043 [ dbSNP | Ensembl ].
    VAR_024315

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. 1 PublicationVSP_008991
    Alternative sequencei1 – 11M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. 1 PublicationVSP_038095

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001444 mRNA. Translation: BAA91695.1.
    AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
    CR457122 mRNA. Translation: CAG33403.1.
    AC020890 Genomic DNA. No translation available.
    BC012478 mRNA. Translation: AAH12478.1.
    BQ638715 mRNA. No translation available.
    CCDSiCCDS3103.1. [Q9NVQ4-1]
    CCDS33864.1. [Q9NVQ4-2]
    CCDS33865.1. [Q9NVQ4-3]
    RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
    NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
    NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
    NP_060617.1. NM_018147.3. [Q9NVQ4-1]
    UniGeneiHs.173438.

    Genome annotation databases

    EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
    ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
    ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
    ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
    ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
    GeneIDi55179.
    KEGGihsa:55179.
    UCSCiuc003eso.1. human. [Q9NVQ4-2]
    uc003esq.3. human. [Q9NVQ4-3]
    uc003esr.3. human. [Q9NVQ4-1]

    Polymorphism databases

    DMDMi38503210.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001444 mRNA. Translation: BAA91695.1 .
    AK125477 mRNA. Translation: BAC86174.1 . Sequence problems.
    CR457122 mRNA. Translation: CAG33403.1 .
    AC020890 Genomic DNA. No translation available.
    BC012478 mRNA. Translation: AAH12478.1 .
    BQ638715 mRNA. No translation available.
    CCDSi CCDS3103.1. [Q9NVQ4-1 ]
    CCDS33864.1. [Q9NVQ4-2 ]
    CCDS33865.1. [Q9NVQ4-3 ]
    RefSeqi NP_001028202.1. NM_001033030.1. [Q9NVQ4-2 ]
    NP_001028203.1. NM_001033031.1. [Q9NVQ4-3 ]
    NP_001028204.1. NM_001033032.1. [Q9NVQ4-1 ]
    NP_060617.1. NM_018147.3. [Q9NVQ4-1 ]
    UniGenei Hs.173438.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2KW1 NMR - A 91-179 [» ]
    3MX7 X-ray 1.76 A 1-90 [» ]
    ProteinModelPortali Q9NVQ4.
    SMRi Q9NVQ4. Positions 1-179.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120478. 2 interactions.

    PTM databases

    PhosphoSitei Q9NVQ4.

    Polymorphism databases

    DMDMi 38503210.

    Proteomic databases

    MaxQBi Q9NVQ4.
    PaxDbi Q9NVQ4.
    PRIDEi Q9NVQ4.

    Protocols and materials databases

    DNASUi 55179.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338446 ; ENSP00000342805 ; ENSG00000158234 . [Q9NVQ4-2 ]
    ENST00000360570 ; ENSP00000353775 ; ENSG00000158234 . [Q9NVQ4-3 ]
    ENST00000393034 ; ENSP00000376754 ; ENSG00000158234 . [Q9NVQ4-1 ]
    ENST00000393035 ; ENSP00000376755 ; ENSG00000158234 . [Q9NVQ4-1 ]
    ENST00000464668 ; ENSP00000417642 ; ENSG00000158234 . [Q9NVQ4-1 ]
    GeneIDi 55179.
    KEGGi hsa:55179.
    UCSCi uc003eso.1. human. [Q9NVQ4-2 ]
    uc003esq.3. human. [Q9NVQ4-3 ]
    uc003esr.3. human. [Q9NVQ4-1 ]

    Organism-specific databases

    CTDi 55179.
    GeneCardsi GC03P138327.
    HGNCi HGNC:18703. FAIM.
    HPAi HPA042440.
    HPA052209.
    neXtProti NX_Q9NVQ4.
    PharmGKBi PA38647.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG296668.
    HOGENOMi HOG000007913.
    HOVERGENi HBG051543.
    InParanoidi Q9NVQ4.
    OMAi AISGFAY.
    OrthoDBi EOG7R56TX.
    PhylomeDBi Q9NVQ4.
    TreeFami TF314971.

    Miscellaneous databases

    ChiTaRSi FAIM. human.
    GenomeRNAii 55179.
    NextBioi 58987.
    PROi Q9NVQ4.

    Gene expression databases

    ArrayExpressi Q9NVQ4.
    Bgeei Q9NVQ4.
    CleanExi HS_FAIM.
    Genevestigatori Q9NVQ4.

    Family and domain databases

    InterProi IPR010695. FAIM.
    [Graphical view ]
    PANTHERi PTHR13088. PTHR13088. 1 hit.
    Pfami PF06905. FAIM1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130 (ISOFORM 2).
      Tissue: Brain.
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-117.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    5. "Expressed sequence tag analysis of human retina for the NEIBank project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts."
      Wistow G., Berstein S.L., Wyatt M.K., Ray S., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K.
      Mol. Vis. 8:196-204(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-151 (ISOFORM 3), VARIANTS THR-117 AND SER-127.
      Tissue: Retina.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiFAIM1_HUMAN
    AccessioniPrimary (citable) accession number: Q9NVQ4
    Secondary accession number(s): Q6IAN2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 21, 2003
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3