Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fas apoptotic inhibitory molecule 1

Gene

FAIM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158234-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Fas apoptotic inhibitory molecule 1
Gene namesi
Name:FAIM
Synonyms:FAIM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:18703. FAIM.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi55179.
OpenTargetsiENSG00000158234.
PharmGKBiPA38647.

Polymorphism and mutation databases

BioMutaiFAIM.
DMDMi38503210.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000871732 – 179Fas apoptotic inhibitory molecule 1Add BLAST178

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NVQ4.
MaxQBiQ9NVQ4.
PaxDbiQ9NVQ4.
PeptideAtlasiQ9NVQ4.
PRIDEiQ9NVQ4.

PTM databases

iPTMnetiQ9NVQ4.
PhosphoSitePlusiQ9NVQ4.

Expressioni

Gene expression databases

BgeeiENSG00000158234.
CleanExiHS_FAIM.
ExpressionAtlasiQ9NVQ4. baseline and differential.
GenevisibleiQ9NVQ4. HS.

Organism-specific databases

HPAiHPA042440.
HPA052209.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SPRY2O435973EBI-10314711,EBI-742487

Protein-protein interaction databases

BioGridi120478. 3 interactors.
IntActiQ9NVQ4. 3 interactors.
STRINGi9606.ENSP00000342805.

Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi4 – 12Combined sources9
Beta strandi15 – 23Combined sources9
Turni25 – 27Combined sources3
Beta strandi30 – 34Combined sources5
Beta strandi37 – 42Combined sources6
Beta strandi50 – 56Combined sources7
Turni57 – 60Combined sources4
Beta strandi61 – 70Combined sources10
Turni71 – 73Combined sources3
Beta strandi74 – 81Combined sources8
Beta strandi84 – 88Combined sources5
Beta strandi98 – 104Combined sources7
Beta strandi107 – 114Combined sources8
Turni115 – 118Combined sources4
Beta strandi119 – 122Combined sources4
Beta strandi125 – 127Combined sources3
Beta strandi130 – 134Combined sources5
Beta strandi137 – 144Combined sources8
Beta strandi147 – 154Combined sources8
Beta strandi157 – 160Combined sources4
Beta strandi164 – 169Combined sources6
Beta strandi172 – 174Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4.
SMRiQ9NVQ4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAIM1 family.Curated

Phylogenomic databases

eggNOGiKOG4352. Eukaryota.
ENOG410XRNP. LUCA.
GeneTreeiENSGT00390000007364.
HOGENOMiHOG000007913.
HOVERGENiHBG051543.
InParanoidiQ9NVQ4.
OMAiGKSHDQY.
OrthoDBiEOG091G0MZK.
PhylomeDBiQ9NVQ4.
TreeFamiTF314971.

Family and domain databases

InterProiIPR010695. FAIM1.
[Graphical view]
PANTHERiPTHR13088. PTHR13088. 1 hit.
PfamiPF06905. FAIM1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to basket
Also known as: FAIM-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG
60 70 80 90 100
KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW
110 120 130 140 150
VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY
160 170
IKAVSSGKRK EGIIHTLIVD NREIPEIAS
Length:179
Mass (Da):20,215
Last modified:October 1, 2000 - v1
Checksum:i129E7E4525535C72
GO
Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

Show »
Length:213
Mass (Da):24,041
Checksum:iF4350AA22E14A727
GO
Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to basket
Also known as: FAIM-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Show »
Length:201
Mass (Da):22,626
Checksum:i785BB238F63F4568
GO

Sequence cautioni

The sequence BAC86174 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti32V → L in BQ638715 (PubMed:12107411).Curated1
Sequence conflicti66N → S in CAG33403 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024314117A → T.2 PublicationsCorresponds to variant rs641320dbSNPEnsembl.1
Natural variantiVAR_024315127L → S.1 PublicationCorresponds to variant rs13043dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0089911M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0380951M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
CCDSiCCDS3103.1. [Q9NVQ4-1]
CCDS33864.1. [Q9NVQ4-2]
CCDS33865.1. [Q9NVQ4-3]
RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
NP_060617.1. NM_018147.3. [Q9NVQ4-1]
UniGeneiHs.173438.

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneIDi55179.
KEGGihsa:55179.
UCSCiuc003esp.4. human. [Q9NVQ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
CCDSiCCDS3103.1. [Q9NVQ4-1]
CCDS33864.1. [Q9NVQ4-2]
CCDS33865.1. [Q9NVQ4-3]
RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
NP_060617.1. NM_018147.3. [Q9NVQ4-1]
UniGeneiHs.173438.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4.
SMRiQ9NVQ4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120478. 3 interactors.
IntActiQ9NVQ4. 3 interactors.
STRINGi9606.ENSP00000342805.

PTM databases

iPTMnetiQ9NVQ4.
PhosphoSitePlusiQ9NVQ4.

Polymorphism and mutation databases

BioMutaiFAIM.
DMDMi38503210.

Proteomic databases

EPDiQ9NVQ4.
MaxQBiQ9NVQ4.
PaxDbiQ9NVQ4.
PeptideAtlasiQ9NVQ4.
PRIDEiQ9NVQ4.

Protocols and materials databases

DNASUi55179.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneIDi55179.
KEGGihsa:55179.
UCSCiuc003esp.4. human. [Q9NVQ4-1]

Organism-specific databases

CTDi55179.
DisGeNETi55179.
GeneCardsiFAIM.
HGNCiHGNC:18703. FAIM.
HPAiHPA042440.
HPA052209.
neXtProtiNX_Q9NVQ4.
OpenTargetsiENSG00000158234.
PharmGKBiPA38647.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4352. Eukaryota.
ENOG410XRNP. LUCA.
GeneTreeiENSGT00390000007364.
HOGENOMiHOG000007913.
HOVERGENiHBG051543.
InParanoidiQ9NVQ4.
OMAiGKSHDQY.
OrthoDBiEOG091G0MZK.
PhylomeDBiQ9NVQ4.
TreeFamiTF314971.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158234-MONOMER.

Miscellaneous databases

ChiTaRSiFAIM. human.
GenomeRNAii55179.
PROiQ9NVQ4.

Gene expression databases

BgeeiENSG00000158234.
CleanExiHS_FAIM.
ExpressionAtlasiQ9NVQ4. baseline and differential.
GenevisibleiQ9NVQ4. HS.

Family and domain databases

InterProiIPR010695. FAIM1.
[Graphical view]
PANTHERiPTHR13088. PTHR13088. 1 hit.
PfamiPF06905. FAIM1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFAIM1_HUMAN
AccessioniPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 21, 2003
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.