SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NVQ4

- FAIM1_HUMAN

UniProt

Q9NVQ4 - FAIM1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Fas apoptotic inhibitory molecule 1
Gene
FAIM, FAIM1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells By similarity.

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. negative regulation of apoptotic process Source: InterPro
  3. negative regulation of extrinsic apoptotic signaling pathway via death domain receptors Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Fas apoptotic inhibitory molecule 1
Gene namesi
Name:FAIM
Synonyms:FAIM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:18703. FAIM.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38647.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 179178Fas apoptotic inhibitory molecule 1
PRO_0000087173Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9NVQ4.
PaxDbiQ9NVQ4.
PRIDEiQ9NVQ4.

PTM databases

PhosphoSiteiQ9NVQ4.

Expressioni

Gene expression databases

ArrayExpressiQ9NVQ4.
BgeeiQ9NVQ4.
CleanExiHS_FAIM.
GenevestigatoriQ9NVQ4.

Organism-specific databases

HPAiHPA042440.
HPA052209.

Interactioni

Protein-protein interaction databases

BioGridi120478. 2 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4 – 129
Beta strandi15 – 239
Turni25 – 273
Beta strandi30 – 345
Beta strandi37 – 426
Beta strandi50 – 567
Turni57 – 604
Beta strandi61 – 7010
Turni71 – 733
Beta strandi74 – 818
Beta strandi84 – 885
Beta strandi98 – 1047
Beta strandi107 – 1148
Turni115 – 1184
Beta strandi119 – 1224
Beta strandi125 – 1273
Beta strandi130 – 1345
Beta strandi137 – 1448
Beta strandi147 – 1548
Beta strandi157 – 1604
Beta strandi164 – 1696
Beta strandi172 – 1743

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4.
SMRiQ9NVQ4. Positions 1-179.

Family & Domainsi

Sequence similaritiesi

Belongs to the FAIM1 family.

Phylogenomic databases

eggNOGiNOG296668.
HOGENOMiHOG000007913.
HOVERGENiHBG051543.
InParanoidiQ9NVQ4.
OMAiAISGFAY.
OrthoDBiEOG7R56TX.
PhylomeDBiQ9NVQ4.
TreeFamiTF314971.

Family and domain databases

InterProiIPR010695. FAIM.
[Graphical view]
PANTHERiPTHR13088. PTHR13088. 1 hit.
PfamiPF06905. FAIM1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to Basket

Also known as: FAIM-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG    50
KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW 100
VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY 150
IKAVSSGKRK EGIIHTLIVD NREIPEIAS 179
Length:179
Mass (Da):20,215
Last modified:October 1, 2000 - v1
Checksum:i129E7E4525535C72
GO
Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

Show »
Length:213
Mass (Da):24,041
Checksum:iF4350AA22E14A727
GO
Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to Basket

Also known as: FAIM-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Show »
Length:201
Mass (Da):22,626
Checksum:i785BB238F63F4568
GO

Sequence cautioni

The sequence BAC86174.1 differs from that shown. Reason: Intron retention.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti117 – 1171A → T.2 Publications
Corresponds to variant rs641320 [ dbSNP | Ensembl ].
VAR_024314
Natural varianti127 – 1271L → S.1 Publication
Corresponds to variant rs13043 [ dbSNP | Ensembl ].
VAR_024315

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2.
VSP_008991
Alternative sequencei1 – 11M → MASGDDSPIFEDDESPPYSL EKM in isoform 3.
VSP_038095

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti32 – 321V → L in BQ638715. 1 Publication
Sequence conflicti66 – 661N → S in CAG33403. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
CCDSiCCDS3103.1. [Q9NVQ4-1]
CCDS33864.1. [Q9NVQ4-2]
CCDS33865.1. [Q9NVQ4-3]
RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
NP_060617.1. NM_018147.3. [Q9NVQ4-1]
UniGeneiHs.173438.

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneIDi55179.
KEGGihsa:55179.
UCSCiuc003eso.1. human. [Q9NVQ4-2]
uc003esq.3. human. [Q9NVQ4-3]
uc003esr.3. human. [Q9NVQ4-1]

Polymorphism databases

DMDMi38503210.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK001444 mRNA. Translation: BAA91695.1 .
AK125477 mRNA. Translation: BAC86174.1 . Sequence problems.
CR457122 mRNA. Translation: CAG33403.1 .
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1 .
BQ638715 mRNA. No translation available.
CCDSi CCDS3103.1. [Q9NVQ4-1 ]
CCDS33864.1. [Q9NVQ4-2 ]
CCDS33865.1. [Q9NVQ4-3 ]
RefSeqi NP_001028202.1. NM_001033030.1. [Q9NVQ4-2 ]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3 ]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1 ]
NP_060617.1. NM_018147.3. [Q9NVQ4-1 ]
UniGenei Hs.173438.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2KW1 NMR - A 91-179 [» ]
3MX7 X-ray 1.76 A 1-90 [» ]
ProteinModelPortali Q9NVQ4.
SMRi Q9NVQ4. Positions 1-179.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120478. 2 interactions.

PTM databases

PhosphoSitei Q9NVQ4.

Polymorphism databases

DMDMi 38503210.

Proteomic databases

MaxQBi Q9NVQ4.
PaxDbi Q9NVQ4.
PRIDEi Q9NVQ4.

Protocols and materials databases

DNASUi 55179.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000338446 ; ENSP00000342805 ; ENSG00000158234 . [Q9NVQ4-2 ]
ENST00000360570 ; ENSP00000353775 ; ENSG00000158234 . [Q9NVQ4-3 ]
ENST00000393034 ; ENSP00000376754 ; ENSG00000158234 . [Q9NVQ4-1 ]
ENST00000393035 ; ENSP00000376755 ; ENSG00000158234 . [Q9NVQ4-1 ]
ENST00000464668 ; ENSP00000417642 ; ENSG00000158234 . [Q9NVQ4-1 ]
GeneIDi 55179.
KEGGi hsa:55179.
UCSCi uc003eso.1. human. [Q9NVQ4-2 ]
uc003esq.3. human. [Q9NVQ4-3 ]
uc003esr.3. human. [Q9NVQ4-1 ]

Organism-specific databases

CTDi 55179.
GeneCardsi GC03P138327.
HGNCi HGNC:18703. FAIM.
HPAi HPA042440.
HPA052209.
neXtProti NX_Q9NVQ4.
PharmGKBi PA38647.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG296668.
HOGENOMi HOG000007913.
HOVERGENi HBG051543.
InParanoidi Q9NVQ4.
OMAi AISGFAY.
OrthoDBi EOG7R56TX.
PhylomeDBi Q9NVQ4.
TreeFami TF314971.

Miscellaneous databases

ChiTaRSi FAIM. human.
GenomeRNAii 55179.
NextBioi 58987.
PROi Q9NVQ4.

Gene expression databases

ArrayExpressi Q9NVQ4.
Bgeei Q9NVQ4.
CleanExi HS_FAIM.
Genevestigatori Q9NVQ4.

Family and domain databases

InterProi IPR010695. FAIM.
[Graphical view ]
PANTHERi PTHR13088. PTHR13088. 1 hit.
Pfami PF06905. FAIM1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130 (ISOFORM 2).
    Tissue: Brain.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-117.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. "Expressed sequence tag analysis of human retina for the NEIBank project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts."
    Wistow G., Berstein S.L., Wyatt M.K., Ray S., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K.
    Mol. Vis. 8:196-204(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-151 (ISOFORM 3), VARIANTS THR-117 AND SER-127.
    Tissue: Retina.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiFAIM1_HUMAN
AccessioniPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 21, 2003
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi