Q9NVQ4 (FAIM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fas apoptotic inhibitory molecule 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 179 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells By similarity. |
| Subcellular location | Cytoplasm By similarity. |
| Sequence similarities | Belongs to the FAIM1 family. |
| Sequence caution | The sequence BAC86174.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW negative regulation of apoptotic processInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NVQ4-1) Also known as: FAIM-S; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NVQ4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM | ||||||
| Isoform 3 (identifier: Q9NVQ4-3) Also known as: FAIM-L; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MASGDDSPIFEDDESPPYSLEKM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 179 | 179 | Fas apoptotic inhibitory molecule 1 | PRO_0000087173 | |||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. | VSP_008991 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. | VSP_038095 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 117 | 1 | A → T. Ref.2 Ref.5 Corresponds to variant rs641320 [ dbSNP | Ensembl ]. | VAR_024314 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 127 | 1 | L → S. Ref.5 Corresponds to variant rs13043 [ dbSNP | Ensembl ]. | VAR_024315 | |||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 32 | 1 | V → L in BQ638715. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 66 | 1 | N → S in CAG33403. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4 – 12 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 15 – 23 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 25 – 27 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 30 – 34 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 37 – 42 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 56 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 57 – 60 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 70 | 10 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 71 – 73 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 74 – 81 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 84 – 88 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 104 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 107 – 114 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 115 – 118 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 119 – 122 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 127 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 134 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 144 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 147 – 154 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 157 – 160 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 169 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 174 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130 (ISOFORM 2). Tissue: Brain. |
| [2] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-117. |
| [3] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [5] | "Expressed sequence tag analysis of human retina for the NEIBank project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts." Wistow G., Berstein S.L., Wyatt M.K., Ray S., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K. Mol. Vis. 8:196-204(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-151 (ISOFORM 3), VARIANTS THR-117 AND SER-127. Tissue: Retina. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK001444 mRNA. Translation: BAA91695.1. AK125477 mRNA. Translation: BAC86174.1. Sequence problems. CR457122 mRNA. Translation: CAG33403.1. AC020890 Genomic DNA. No translation available. BC012478 mRNA. Translation: AAH12478.1. BQ638715 mRNA. No translation available. | ||||||||||||||||||
| IPI | IPI00018733. IPI00394989. IPI00651712. | ||||||||||||||||||
| RefSeq | NP_001028202.1. NM_001033030.1. NP_001028203.1. NM_001033031.1. NP_001028204.1. NM_001033032.1. NP_060617.1. NM_018147.3. | ||||||||||||||||||
| UniGene | Hs.173438. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9NVQ4. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9NVQ4. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 38503210. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9NVQ4. | ||||||||||||||||||
| PRIDE | Q9NVQ4. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 55179. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000338446; ENSP00000342805; ENSG00000158234. ENST00000360570; ENSP00000353775; ENSG00000158234. ENST00000393034; ENSP00000376754; ENSG00000158234. ENST00000393035; ENSP00000376755; ENSG00000158234. ENST00000464668; ENSP00000417642; ENSG00000158234. | ||||||||||||||||||
| GeneID | 55179. | ||||||||||||||||||
| KEGG | hsa:55179. | ||||||||||||||||||
| UCSC | uc003eso.1. human. uc003esq.3. human. uc003esr.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 55179. | ||||||||||||||||||
| GeneCards | GC03P138327. | ||||||||||||||||||
| HGNC | HGNC:18703. FAIM. | ||||||||||||||||||
| HPA | HPA042440. HPA052209. | ||||||||||||||||||
| neXtProt | NX_Q9NVQ4. | ||||||||||||||||||
| PharmGKB | PA38647. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG296668. | ||||||||||||||||||
| HOGENOM | HOG000007913. | ||||||||||||||||||
| HOVERGEN | HBG051543. | ||||||||||||||||||
| InParanoid | Q9NVQ4. | ||||||||||||||||||
| OMA | GKKMETA. | ||||||||||||||||||
| OrthoDB | EOG49CQ8M. | ||||||||||||||||||
| PhylomeDB | Q9NVQ4. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | trkrpathway. Neurotrophic factor-mediated Trk receptor signaling. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9NVQ4. | ||||||||||||||||||
| Bgee | Q9NVQ4. | ||||||||||||||||||
| CleanEx | HS_FAIM. | ||||||||||||||||||
| Genevestigator | Q9NVQ4. | ||||||||||||||||||
| GermOnline | ENSG00000158234. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR010695. FAIM. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR13088. PTHR13088. 1 hit. | ||||||||||||||||||
| Pfam | PF06905. FAIM1. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | FAIM. human. | ||||||||||||||||||
| GenomeRNAi | 55179. | ||||||||||||||||||
| NextBio | 58987. | ||||||||||||||||||
Entry information
| Entry name | FAIM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVQ4 Secondary accession number(s): Q6IAN2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
