Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fas apoptotic inhibitory molecule 1

Gene

FAIM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.By similarity

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. negative regulation of apoptotic process Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Fas apoptotic inhibitory molecule 1
Gene namesi
Name:FAIM
Synonyms:FAIM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:18703. FAIM.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38647.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 179178Fas apoptotic inhibitory molecule 1PRO_0000087173Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9NVQ4.
PaxDbiQ9NVQ4.
PRIDEiQ9NVQ4.

PTM databases

PhosphoSiteiQ9NVQ4.

Expressioni

Gene expression databases

BgeeiQ9NVQ4.
CleanExiHS_FAIM.
ExpressionAtlasiQ9NVQ4. baseline and differential.
GenevestigatoriQ9NVQ4.

Organism-specific databases

HPAiHPA042440.
HPA052209.

Interactioni

Protein-protein interaction databases

BioGridi120478. 3 interactions.

Structurei

Secondary structure

1
179
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4 – 129Combined sources
Beta strandi15 – 239Combined sources
Turni25 – 273Combined sources
Beta strandi30 – 345Combined sources
Beta strandi37 – 426Combined sources
Beta strandi50 – 567Combined sources
Turni57 – 604Combined sources
Beta strandi61 – 7010Combined sources
Turni71 – 733Combined sources
Beta strandi74 – 818Combined sources
Beta strandi84 – 885Combined sources
Beta strandi98 – 1047Combined sources
Beta strandi107 – 1148Combined sources
Turni115 – 1184Combined sources
Beta strandi119 – 1224Combined sources
Beta strandi125 – 1273Combined sources
Beta strandi130 – 1345Combined sources
Beta strandi137 – 1448Combined sources
Beta strandi147 – 1548Combined sources
Beta strandi157 – 1604Combined sources
Beta strandi164 – 1696Combined sources
Beta strandi172 – 1743Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4.
SMRiQ9NVQ4. Positions 1-179.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAIM1 family.Curated

Phylogenomic databases

eggNOGiNOG296668.
GeneTreeiENSGT00390000007364.
HOGENOMiHOG000007913.
HOVERGENiHBG051543.
InParanoidiQ9NVQ4.
OMAiAISGFAY.
OrthoDBiEOG7R56TX.
PhylomeDBiQ9NVQ4.
TreeFamiTF314971.

Family and domain databases

InterProiIPR010695. FAIM.
[Graphical view]
PANTHERiPTHR13088. PTHR13088. 1 hit.
PfamiPF06905. FAIM1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NVQ4-1) [UniParc]FASTAAdd to basket

Also known as: FAIM-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG
60 70 80 90 100
KETFYVGAAK TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW
110 120 130 140 150
VLHMDGENFR IVLEKDAMDV WCNGKKLETA GEFVDDGTET HFSIGNHDCY
160 170
IKAVSSGKRK EGIIHTLIVD NREIPEIAS
Length:179
Mass (Da):20,215
Last modified:September 30, 2000 - v1
Checksum:i129E7E4525535C72
GO
Isoform 2 (identifier: Q9NVQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM

Show »
Length:213
Mass (Da):24,041
Checksum:iF4350AA22E14A727
GO
Isoform 3 (identifier: Q9NVQ4-3) [UniParc]FASTAAdd to basket

Also known as: FAIM-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Show »
Length:201
Mass (Da):22,626
Checksum:i785BB238F63F4568
GO

Sequence cautioni

The sequence BAC86174.1 differs from that shown.Intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti32 – 321V → L in BQ638715 (PubMed:12107411).Curated
Sequence conflicti66 – 661N → S in CAG33403 (Ref. 2) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti117 – 1171A → T.2 Publications
Corresponds to variant rs641320 [ dbSNP | Ensembl ].
VAR_024314
Natural varianti127 – 1271L → S.1 Publication
Corresponds to variant rs13043 [ dbSNP | Ensembl ].
VAR_024315

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2. 1 PublicationVSP_008991
Alternative sequencei1 – 11M → MASGDDSPIFEDDESPPYSL EKM in isoform 3. 1 PublicationVSP_038095

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
CCDSiCCDS3103.1. [Q9NVQ4-1]
CCDS33864.1. [Q9NVQ4-2]
CCDS33865.1. [Q9NVQ4-3]
RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
NP_060617.1. NM_018147.3. [Q9NVQ4-1]
UniGeneiHs.173438.

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneIDi55179.
KEGGihsa:55179.
UCSCiuc003eso.1. human. [Q9NVQ4-2]
uc003esq.3. human. [Q9NVQ4-3]
uc003esr.3. human. [Q9NVQ4-1]

Polymorphism databases

DMDMi38503210.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
CCDSiCCDS3103.1. [Q9NVQ4-1]
CCDS33864.1. [Q9NVQ4-2]
CCDS33865.1. [Q9NVQ4-3]
RefSeqiNP_001028202.1. NM_001033030.1. [Q9NVQ4-2]
NP_001028203.1. NM_001033031.1. [Q9NVQ4-3]
NP_001028204.1. NM_001033032.1. [Q9NVQ4-1]
NP_060617.1. NM_018147.3. [Q9NVQ4-1]
UniGeneiHs.173438.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortaliQ9NVQ4.
SMRiQ9NVQ4. Positions 1-179.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120478. 3 interactions.

PTM databases

PhosphoSiteiQ9NVQ4.

Polymorphism databases

DMDMi38503210.

Proteomic databases

MaxQBiQ9NVQ4.
PaxDbiQ9NVQ4.
PRIDEiQ9NVQ4.

Protocols and materials databases

DNASUi55179.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneIDi55179.
KEGGihsa:55179.
UCSCiuc003eso.1. human. [Q9NVQ4-2]
uc003esq.3. human. [Q9NVQ4-3]
uc003esr.3. human. [Q9NVQ4-1]

Organism-specific databases

CTDi55179.
GeneCardsiGC03P138327.
HGNCiHGNC:18703. FAIM.
HPAiHPA042440.
HPA052209.
neXtProtiNX_Q9NVQ4.
PharmGKBiPA38647.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG296668.
GeneTreeiENSGT00390000007364.
HOGENOMiHOG000007913.
HOVERGENiHBG051543.
InParanoidiQ9NVQ4.
OMAiAISGFAY.
OrthoDBiEOG7R56TX.
PhylomeDBiQ9NVQ4.
TreeFamiTF314971.

Miscellaneous databases

ChiTaRSiFAIM. human.
GenomeRNAii55179.
NextBioi58987.
PROiQ9NVQ4.

Gene expression databases

BgeeiQ9NVQ4.
CleanExiHS_FAIM.
ExpressionAtlasiQ9NVQ4. baseline and differential.
GenevestigatoriQ9NVQ4.

Family and domain databases

InterProiIPR010695. FAIM.
[Graphical view]
PANTHERiPTHR13088. PTHR13088. 1 hit.
PfamiPF06905. FAIM1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130 (ISOFORM 2).
    Tissue: Brain.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-117.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. "Expressed sequence tag analysis of human retina for the NEIBank project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts."
    Wistow G., Berstein S.L., Wyatt M.K., Ray S., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K.
    Mol. Vis. 8:196-204(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-151 (ISOFORM 3), VARIANTS THR-117 AND SER-127.
    Tissue: Retina.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiFAIM1_HUMAN
AccessioniPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 20, 2003
Last sequence update: September 30, 2000
Last modified: February 3, 2015
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.