Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NVQ4 (FAIM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fas apoptotic inhibitory molecule 1
Gene names
Name:FAIM
Synonyms:FAIM1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length179 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells By similarity.

Subcellular location

Cytoplasm By similarity.

Sequence similarities

Belongs to the FAIM1 family.

Sequence caution

The sequence BAC86174.1 differs from that shown. Reason: Intron retention.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NVQ4-1)

Also known as: FAIM-S;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NVQ4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKM
Isoform 3 (identifier: Q9NVQ4-3)

Also known as: FAIM-L;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGDDSPIFEDDESPPYSLEKM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.6
Chain2 – 179178Fas apoptotic inhibitory molecule 1
PRO_0000087173

Amino acid modifications

Modified residue21N-acetylthreonine Ref.6

Natural variations

Alternative sequence11M → MLLPFIRTLPLLCYNHLLVS PDSATLSPPYSLEKM in isoform 2.
VSP_008991
Alternative sequence11M → MASGDDSPIFEDDESPPYSL EKM in isoform 3.
VSP_038095
Natural variant1171A → T. Ref.2 Ref.5
Corresponds to variant rs641320 [ dbSNP | Ensembl ].
VAR_024314
Natural variant1271L → S. Ref.5
Corresponds to variant rs13043 [ dbSNP | Ensembl ].
VAR_024315

Experimental info

Sequence conflict321V → L in BQ638715. Ref.5
Sequence conflict661N → S in CAG33403. Ref.2

Secondary structure

....................................... 179
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (FAIM-S) [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 129E7E4525535C72

FASTA17920,215
        10         20         30         40         50         60 
MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG KETFYVGAAK 

        70         80         90        100        110        120 
TKATINIDAI SGFAYEYTLE INGKSLKKYM EDRSKTTNTW VLHMDGENFR IVLEKDAMDV 

       130        140        150        160        170 
WCNGKKLETA GEFVDDGTET HFSIGNHDCY IKAVSSGKRK EGIIHTLIVD NREIPEIAS 

« Hide

Isoform 2 [UniParc].

Checksum: F4350AA22E14A727
Show »

FASTA21324,041
Isoform 3 (FAIM-L) [UniParc].

Checksum: 785BB238F63F4568
Show »

FASTA20122,626

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130 (ISOFORM 2).
Tissue: Brain.
[2]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-117.
[3]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[5]"Expressed sequence tag analysis of human retina for the NEIBank project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts."
Wistow G., Berstein S.L., Wyatt M.K., Ray S., Behal A., Touchman J.W., Bouffard G., Smith D., Peterson K.
Mol. Vis. 8:196-204(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-151 (ISOFORM 3), VARIANTS THR-117 AND SER-127.
Tissue: Retina.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK001444 mRNA. Translation: BAA91695.1.
AK125477 mRNA. Translation: BAC86174.1. Sequence problems.
CR457122 mRNA. Translation: CAG33403.1.
AC020890 Genomic DNA. No translation available.
BC012478 mRNA. Translation: AAH12478.1.
BQ638715 mRNA. No translation available.
RefSeqNP_001028202.1. NM_001033030.1.
NP_001028203.1. NM_001033031.1.
NP_001028204.1. NM_001033032.1.
NP_060617.1. NM_018147.3.
UniGeneHs.173438.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2KW1NMR-A91-179[»]
3MX7X-ray1.76A1-90[»]
ProteinModelPortalQ9NVQ4.
SMRQ9NVQ4. Positions 1-179.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120478. 1 interaction.

PTM databases

PhosphoSiteQ9NVQ4.

Polymorphism databases

DMDM38503210.

Proteomic databases

PaxDbQ9NVQ4.
PRIDEQ9NVQ4.

Protocols and materials databases

DNASU55179.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000338446; ENSP00000342805; ENSG00000158234. [Q9NVQ4-2]
ENST00000360570; ENSP00000353775; ENSG00000158234. [Q9NVQ4-3]
ENST00000393034; ENSP00000376754; ENSG00000158234. [Q9NVQ4-1]
ENST00000393035; ENSP00000376755; ENSG00000158234. [Q9NVQ4-1]
ENST00000464668; ENSP00000417642; ENSG00000158234. [Q9NVQ4-1]
GeneID55179.
KEGGhsa:55179.
UCSCuc003eso.1. human. [Q9NVQ4-2]
uc003esq.3. human. [Q9NVQ4-3]
uc003esr.3. human. [Q9NVQ4-1]

Organism-specific databases

CTD55179.
GeneCardsGC03P138327.
HGNCHGNC:18703. FAIM.
HPAHPA042440.
HPA052209.
neXtProtNX_Q9NVQ4.
PharmGKBPA38647.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG296668.
HOGENOMHOG000007913.
HOVERGENHBG051543.
InParanoidQ9NVQ4.
OMAAISGFAY.
OrthoDBEOG7R56TX.
PhylomeDBQ9NVQ4.
TreeFamTF314971.

Gene expression databases

ArrayExpressQ9NVQ4.
BgeeQ9NVQ4.
CleanExHS_FAIM.
GenevestigatorQ9NVQ4.

Family and domain databases

InterProIPR010695. FAIM.
[Graphical view]
PANTHERPTHR13088. PTHR13088. 1 hit.
PfamPF06905. FAIM1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFAIM. human.
GenomeRNAi55179.
NextBio58987.
PROQ9NVQ4.

Entry information

Entry nameFAIM1_HUMAN
AccessionPrimary (citable) accession number: Q9NVQ4
Secondary accession number(s): Q6IAN2
Entry history
Integrated into UniProtKB/Swiss-Prot: November 21, 2003
Last sequence update: October 1, 2000
Last modified: March 19, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM