Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Double zinc ribbon and ankyrin repeat-containing protein 1

Gene

DZANK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri211 – 27060DZANK-type 1Add
BLAST
Zinc fingeri339 – 38749DZANK-type 2Add
BLAST

GO - Molecular functioni

GO - Biological processi

  • mitophagy in response to mitochondrial depolarization Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Double zinc ribbon and ankyrin repeat-containing protein 1
Gene namesi
Name:DZANK1
Synonyms:C20orf12, C20orf84
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:15858. DZANK1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25660.

Polymorphism and mutation databases

BioMutaiDZANK1.
DMDMi363548518.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 752752Double zinc ribbon and ankyrin repeat-containing protein 1PRO_0000066986Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei160 – 1601PhosphoserineBy similarity
Modified residuei182 – 1821PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NVP4.
PaxDbiQ9NVP4.
PeptideAtlasiQ9NVP4.
PRIDEiQ9NVP4.

PTM databases

iPTMnetiQ9NVP4.
PhosphoSiteiQ9NVP4.

Expressioni

Gene expression databases

BgeeiENSG00000089091.
CleanExiHS_C20orf12.
ExpressionAtlasiQ9NVP4. baseline and differential.
GenevisibleiQ9NVP4. HS.

Organism-specific databases

HPAiHPA059478.

Interactioni

Protein-protein interaction databases

BioGridi120483. 2 interactions.
IntActiQ9NVP4. 1 interaction.
MINTiMINT-2874146.
STRINGi9606.ENSP00000262547.

Structurei

3D structure databases

ProteinModelPortaliQ9NVP4.
SMRiQ9NVP4. Positions 619-723.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati605 – 63632ANK 1Add
BLAST
Repeati640 – 66930ANK 2Add
BLAST

Sequence similaritiesi

Contains 2 ANK repeats.Curated
Contains 2 DZANK-type zinc fingers.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri211 – 27060DZANK-type 1Add
BLAST
Zinc fingeri339 – 38749DZANK-type 2Add
BLAST

Keywords - Domaini

ANK repeat, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IEZB. Eukaryota.
ENOG410XPI2. LUCA.
GeneTreeiENSGT00390000000549.
HOVERGENiHBG063313.
InParanoidiQ9NVP4.
OMAiQWGPLRN.
OrthoDBiEOG091G02LT.
PhylomeDBiQ9NVP4.
TreeFamiTF351270.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR020683. Ankyrin_rpt-contain_dom.
IPR025874. DZR.
IPR026876. Fn3_assoc_repeat.
[Graphical view]
PfamiPF12773. DZR. 1 hit.
PF13287. Fn3_assoc. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NVP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAGSVCVPQ IIPLRVPQPG KANHEIDNNT LLEMKSDTPD VNIYYTLDGS
60 70 80 90 100
KPEFLKRIGY GENNTFKYIK PITLPDGKIQ VKAIAVSKDC RQSGIVTKVF
110 120 130 140 150
HVDYEPPNIV SPEDNVENVL KDSSRQEFKN GFVGSKLKKK YKNSENQRSW
160 170 180 190 200
NVNLRKFPES PLEIPAYGGG SGSRPPTRQS QSPGFAHVSG QKCLTSTEIM
210 220 230 240 250
RIQRETDFLK CAHCLAPRPS DPFARFCQEC GSPVPPIFGC RLPPPEGAQM
260 270 280 290 300
GLCAECRSLV PMNTPICVVC EAPLALQLQP QASLHLKEKV ICRACGTGNP
310 320 330 340 350
AHLRYCVTCE GALPSSQESM CSGDKAPPPP TQKGGTISCY RCGRWNLWEA
360 370 380 390 400
SFCGWCGAML GIPAGCSVCP KCGASNHLSA RFCGSCGICV KSLVKLSLDR
410 420 430 440 450
SLALAAEEPR PFSESLNIPL PRSDVGTKRD IGTQTVGLFY PSGKLLAKKE
460 470 480 490 500
QELASQKQRQ EKMSDHKPLL TAISPGRGYW RRQLDHISAH LRCYAQNNPE
510 520 530 540 550
FRALIAEPRM GKLISATVHE DGCEVSIRLN YSQVSNKNLY LNKAVNFSDH
560 570 580 590 600
LLSSAAEGDG GLCGSRSSWV SDYSQSTSDT IEKIKRIKNF KTKTFQEKKE
610 620 630 640 650
QLIPENRLLL KEVGPTGEGR VSVIEQLLDE GADPNCCDED NRPVITVAVM
660 670 680 690 700
NKHHEAIPVL VQRGADIDQQ WGPLRNTALH EATLLGLAGR ESTATLLGCN
710 720 730 740 750
ASIQKKNAGG QTAYDLALNT GDDLVTSLFA AKFGQGLEDQ LAQTRSLSLD

DC
Length:752
Mass (Da):82,192
Last modified:December 14, 2011 - v3
Checksum:iCF2DCF2969706264
GO
Isoform 2 (identifier: Q9NVP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: Missing.
     174-180: RPPTRQS → MLTLESF
     414-414: E → EPRCAWQ

Note: No experimental confirmation available.
Show »
Length:585
Mass (Da):63,651
Checksum:i76E4D520E669D34E
GO
Isoform 3 (identifier: Q9NVP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     538-574: NLYLNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYS → VRKLRLREVKQPASSKGTKLVSGRPRIHTWQPETFPS
     575-752: Missing.

Show »
Length:574
Mass (Da):63,163
Checksum:i99D98A3A81100CF2
GO
Isoform 4 (identifier: Q9NVP4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     115-180: NVENVLKDSS...SGSRPPTRQS → MLTLESFQRV...GRTLFRRLLF

Show »
Length:638
Mass (Da):70,071
Checksum:i25C63FE48F1B0E6E
GO
Isoform 5 (identifier: Q9NVP4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     319-359: Missing.

Show »
Length:711
Mass (Da):77,769
Checksum:iC4E442BA47D34D5E
GO

Sequence cautioni

The sequence BAA91706 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB70949 differs from that shown. Reason: Erroneous termination at position 569. Translated as Trp.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti272 – 2721A → V in BAB70949 (PubMed:14702039).Curated
Sequence conflicti603 – 6031I → L in AAZ13595 (Ref. 6) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 173173Missing in isoform 2. 1 PublicationVSP_042090Add
BLAST
Alternative sequencei1 – 114114Missing in isoform 4. 1 PublicationVSP_042091Add
BLAST
Alternative sequencei115 – 18066NVENV…PTRQS → MLTLESFQRVHWKSQLMVED QVLDHPPASPRQDTVPFTFK SFLFGHSMEIRPWKRKGRTL FRRLLF in isoform 4. 1 PublicationVSP_042092Add
BLAST
Alternative sequencei174 – 1807RPPTRQS → MLTLESF in isoform 2. 1 PublicationVSP_042093
Alternative sequencei319 – 35941Missing in isoform 5. 1 PublicationVSP_042094Add
BLAST
Alternative sequencei414 – 4141E → EPRCAWQ in isoform 2. 1 PublicationVSP_042095
Alternative sequencei538 – 57437NLYLN…VSDYS → VRKLRLREVKQPASSKGTKL VSGRPRIHTWQPETFPS in isoform 3. 1 PublicationVSP_042096Add
BLAST
Alternative sequencei575 – 752178Missing in isoform 3. 1 PublicationVSP_042097Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001462 mRNA. Translation: BAA91706.1. Different initiation.
AK055544 mRNA. Translation: BAB70949.1. Sequence problems.
AK131451 mRNA. Translation: BAD18596.1.
CR749327 mRNA. Translation: CAH18182.1.
AL049646, AL121893 Genomic DNA. Translation: CAI21830.1.
AL049646, AL121893 Genomic DNA. Translation: CAI21831.1.
AL121893, AL049646 Genomic DNA. Translation: CAI12510.1.
AL121893, AL049646 Genomic DNA. Translation: CAI12511.1.
CH471133 Genomic DNA. Translation: EAX10244.1.
BC144153 mRNA. Translation: AAI44154.1.
DQ104738 mRNA. Translation: AAZ13595.1.
CCDSiCCDS46582.1. [Q9NVP4-1]
RefSeqiNP_001092877.1. NM_001099407.1. [Q9NVP4-1]
XP_005260800.1. XM_005260743.3. [Q9NVP4-2]
XP_011527577.1. XM_011529275.2. [Q9NVP4-2]
UniGeneiHs.472225.

Genome annotation databases

EnsembliENST00000262547; ENSP00000262547; ENSG00000089091. [Q9NVP4-1]
ENST00000358866; ENSP00000351734; ENSG00000089091. [Q9NVP4-1]
ENST00000609267; ENSP00000477046; ENSG00000089091. [Q9NVP4-3]
GeneIDi55184.
KEGGihsa:55184.
UCSCiuc002wqq.5. human. [Q9NVP4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001462 mRNA. Translation: BAA91706.1. Different initiation.
AK055544 mRNA. Translation: BAB70949.1. Sequence problems.
AK131451 mRNA. Translation: BAD18596.1.
CR749327 mRNA. Translation: CAH18182.1.
AL049646, AL121893 Genomic DNA. Translation: CAI21830.1.
AL049646, AL121893 Genomic DNA. Translation: CAI21831.1.
AL121893, AL049646 Genomic DNA. Translation: CAI12510.1.
AL121893, AL049646 Genomic DNA. Translation: CAI12511.1.
CH471133 Genomic DNA. Translation: EAX10244.1.
BC144153 mRNA. Translation: AAI44154.1.
DQ104738 mRNA. Translation: AAZ13595.1.
CCDSiCCDS46582.1. [Q9NVP4-1]
RefSeqiNP_001092877.1. NM_001099407.1. [Q9NVP4-1]
XP_005260800.1. XM_005260743.3. [Q9NVP4-2]
XP_011527577.1. XM_011529275.2. [Q9NVP4-2]
UniGeneiHs.472225.

3D structure databases

ProteinModelPortaliQ9NVP4.
SMRiQ9NVP4. Positions 619-723.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120483. 2 interactions.
IntActiQ9NVP4. 1 interaction.
MINTiMINT-2874146.
STRINGi9606.ENSP00000262547.

PTM databases

iPTMnetiQ9NVP4.
PhosphoSiteiQ9NVP4.

Polymorphism and mutation databases

BioMutaiDZANK1.
DMDMi363548518.

Proteomic databases

EPDiQ9NVP4.
PaxDbiQ9NVP4.
PeptideAtlasiQ9NVP4.
PRIDEiQ9NVP4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262547; ENSP00000262547; ENSG00000089091. [Q9NVP4-1]
ENST00000358866; ENSP00000351734; ENSG00000089091. [Q9NVP4-1]
ENST00000609267; ENSP00000477046; ENSG00000089091. [Q9NVP4-3]
GeneIDi55184.
KEGGihsa:55184.
UCSCiuc002wqq.5. human. [Q9NVP4-1]

Organism-specific databases

CTDi55184.
GeneCardsiDZANK1.
H-InvDBHIX0015666.
HGNCiHGNC:15858. DZANK1.
HPAiHPA059478.
neXtProtiNX_Q9NVP4.
PharmGKBiPA25660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEZB. Eukaryota.
ENOG410XPI2. LUCA.
GeneTreeiENSGT00390000000549.
HOVERGENiHBG063313.
InParanoidiQ9NVP4.
OMAiQWGPLRN.
OrthoDBiEOG091G02LT.
PhylomeDBiQ9NVP4.
TreeFamiTF351270.

Miscellaneous databases

GenomeRNAii55184.
PROiQ9NVP4.

Gene expression databases

BgeeiENSG00000089091.
CleanExiHS_C20orf12.
ExpressionAtlasiQ9NVP4. baseline and differential.
GenevisibleiQ9NVP4. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR020683. Ankyrin_rpt-contain_dom.
IPR025874. DZR.
IPR026876. Fn3_assoc_repeat.
[Graphical view]
PfamiPF12773. DZR. 1 hit.
PF13287. Fn3_assoc. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDZAN1_HUMAN
AccessioniPrimary (citable) accession number: Q9NVP4
Secondary accession number(s): B7ZLZ4
, Q4F7X1, Q5QPD9, Q5QPE0, Q68DN8, Q6ZMX9, Q96NF0, Q9H1E0, Q9H442
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: December 14, 2011
Last modified: September 7, 2016
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.