Reviewed,
UniProtKB/Swiss-Prot Q9NVP4 (CT012_HUMAN)
Last modified
November 24, 2009.
Version 72.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Ankyrin repeat-containing protein C20orf12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 579 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Sequence similarities | Contains 2 ANK repeats. |
| Sequence caution | The sequence BAB70949.1 differs from that shown. Reason: Erroneous termination at position 396. Translated as Trp. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NVP4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NVP4-2) The sequence of this isoform differs from the canonical sequence as follows: 241-241: E → EPRCAWQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NVP4-3) The sequence of this isoform differs from the canonical sequence as follows: 146-186: Missing. | ||||||
| Isoform 4 (identifier: Q9NVP4-4) The sequence of this isoform differs from the canonical sequence as follows: 6-6: S → SFQRVHWKSQLMVEDQVLDHPPASPRQDTVPFTFKSFLFGHSMEIRPWKRKGRTLFRRLL | ||||||
| Isoform 5 (identifier: Q9NVP4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-7: MLTLESF → MTAGSVCVPQ...SGSRPPTRQS 365-424: NLYLNKAVNF...KNFKTKTFQE → VRKLRLREVK...HTWQPETFPS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 579 | 579 | Ankyrin repeat-containing protein C20orf12 | PRO_0000066986 | |||||
Regions | |||||||||
| Repeat | 432 – 463 | 32 | ANK 1 | ||||||
| Repeat | 467 – 496 | 30 | ANK 2 | ||||||
| Compositional bias | 154 – 157 | 4 | Poly-Pro | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 7 | 7 | MLTLESF → MTAGSVCVPQIIPLRVPQPG KANHEIDNNTLLEMKSDTPD VNIYYTLDGSKPEFLKRIGY GENNTFKYIKPITLPDGKIQ VKAIAVSKDCRQSGIVTKVF HVDYEPPNIVSPEDNVENVL KDSSRQEFKNGFVGSKLKKK YKNSENQRSWNVNLRKFPES PLEIPAYGGGSGSRPPTRQS in isoform 5. | VSP_018538 | |||||
| Alternative sequence | 6 | 1 | S → SFQRVHWKSQLMVEDQVLDH PPASPRQDTVPFTFKSFLFG HSMEIRPWKRKGRTLFRRLL in isoform 4. | VSP_018539 | |||||
| Alternative sequence | 146 – 186 | 41 | Missing in isoform 3. | VSP_018540 | |||||
| Alternative sequence | 241 | 1 | E → EPRCAWQ in isoform 2. | VSP_000274 | |||||
| Alternative sequence | 365 – 424 | 60 | NLYLN…KTFQE → VRKLRLREVKQPASSKGTKL VSGRPRIHTWQPETFPS in isoform 5. | VSP_018541 | |||||
Experimental info | |||||||||
| Sequence conflict | 99 | 1 | A → V in BAB70949. Ref.1 | ||||||
| Sequence conflict | 430 | 1 | I → L in AAZ13595. Ref.4 | ||||||
| Sequence conflict | 493 | 1 | D → N in BAA91706. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AK001462 mRNA. Translation: BAA91706.1. Different initiation. AK055544 mRNA. Translation: BAB70949.1. Sequence problems. AK131451 mRNA. Translation: BAD18596.1. CR749327 mRNA. Translation: CAH18182.1. AL049646, AL121893 Genomic DNA. Translation: CAI21830.1. AL049646, AL121893 Genomic DNA. Translation: CAI21831.1. AL121893, AL049646 Genomic DNA. Translation: CAI12510.1. AL121893, AL049646 Genomic DNA. Translation: CAI12511.1. DQ104738 mRNA. Translation: AAZ13595.1. | |
| IPI | IPI00470914. IPI00472239. IPI00514911. IPI00744796. IPI00749404. |
| RefSeq | NP_001092877.1. |
| UniGene | Hs.472225 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NVP4. 1 interaction. |
PTM databases | |
| PhosphoSite | Q9NVP4. |
Proteomic databases | |
| PRIDE | Q9NVP4. |
Genome annotation databases | |
| Ensembl | ENST00000357236; ENSP00000349774; ENSG00000089091; Homo sapiens. [Genome view] |
| GeneID | 55184. |
| KEGG | hsa:55184. |
| UCSC | uc002wqs.2. human. |
Organism-specific databases | |
| CTD | 55184. |
| GeneCards | GC20M018312. |
| HGNC | HGNC:15858. C20orf12. |
| PharmGKB | PA25660. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9NVP4. |
Gene expression databases | |
| ArrayExpress | Q9NVP4. |
| Bgee | Q9NVP4. |
| CleanEx | HS_C20orf12. |
| Genevestigator | Q9NVP4. |
| GermOnline | ENSG00000089091. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001876. Znf_RanBP2. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. |
| Pfam | PF00023. Ank. 3 hits. [Graphical view] |
| SMART | SM00248. ANK. 2 hits. SM00547. ZnF_RBZ. 2 hits. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 59019. |
Entry information
| Entry name | CT012_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVP4 Secondary accession number(s): Q4F7X1 Q9H442 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


