Q9NVP4 (DZAN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double zinc ribbon and ankyrin repeat-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 752 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 2 ANK repeats. Contains 2 DZANK-type zinc fingers. |
| Sequence caution | The sequence BAA91706.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB70949.1 differs from that shown. Reason: Erroneous termination at position 569. Translated as Trp. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NVP4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NVP4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-173: Missing. 174-180: RPPTRQS → MLTLESF 414-414: E → EPRCAWQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NVP4-3) The sequence of this isoform differs from the canonical sequence as follows: 538-574: NLYLNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYS → VRKLRLREVKQPASSKGTKLVSGRPRIHTWQPETFPS 575-752: Missing. | ||||||
| Isoform 4 (identifier: Q9NVP4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-114: Missing. 115-180: NVENVLKDSS...SGSRPPTRQS → MLTLESFQRV...GRTLFRRLLF | ||||||
| Isoform 5 (identifier: Q9NVP4-5) The sequence of this isoform differs from the canonical sequence as follows: 319-359: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 752 | 752 | Double zinc ribbon and ankyrin repeat-containing protein 1 | PRO_0000066986 | |||||
Regions | |||||||||
| Repeat | 605 – 636 | 32 | ANK 1 | ||||||
| Repeat | 640 – 669 | 30 | ANK 2 | ||||||
| Zinc finger | 211 – 270 | 60 | DZANK-type 1 | ||||||
| Zinc finger | 339 – 387 | 49 | DZANK-type 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 173 | 173 | Missing in isoform 2. | VSP_042090 | |||||
| Alternative sequence | 1 – 114 | 114 | Missing in isoform 4. | VSP_042091 | |||||
| Alternative sequence | 115 – 180 | 66 | NVENV…PTRQS → MLTLESFQRVHWKSQLMVED QVLDHPPASPRQDTVPFTFK SFLFGHSMEIRPWKRKGRTL FRRLLF in isoform 4. | VSP_042092 | |||||
| Alternative sequence | 174 – 180 | 7 | RPPTRQS → MLTLESF in isoform 2. | VSP_042093 | |||||
| Alternative sequence | 319 – 359 | 41 | Missing in isoform 5. | VSP_042094 | |||||
| Alternative sequence | 414 | 1 | E → EPRCAWQ in isoform 2. | VSP_042095 | |||||
| Alternative sequence | 538 – 574 | 37 | NLYLN…VSDYS → VRKLRLREVKQPASSKGTKL VSGRPRIHTWQPETFPS in isoform 3. | VSP_042096 | |||||
| Alternative sequence | 575 – 752 | 178 | Missing in isoform 3. | VSP_042097 | |||||
Experimental info | |||||||||
| Sequence conflict | 272 | 1 | A → V in BAB70949. Ref.1 | ||||||
| Sequence conflict | 603 | 1 | I → L in AAZ13595. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK001462 mRNA. Translation: BAA91706.1. Different initiation. AK055544 mRNA. Translation: BAB70949.1. Sequence problems. AK131451 mRNA. Translation: BAD18596.1. CR749327 mRNA. Translation: CAH18182.1. AL049646, AL121893 Genomic DNA. Translation: CAI21830.1. AL049646, AL121893 Genomic DNA. Translation: CAI21831.1. AL121893, AL049646 Genomic DNA. Translation: CAI12510.1. AL121893, AL049646 Genomic DNA. Translation: CAI12511.1. CH471133 Genomic DNA. Translation: EAX10244.1. BC144153 mRNA. Translation: AAI44154.1. DQ104738 mRNA. Translation: AAZ13595.1. |
| IPI | IPI00470914. IPI00472239. IPI00514911. IPI00744796. IPI00749404. IPI01008837. |
| RefSeq | NP_001092877.1. NM_001099407.1. |
| UniGene | Hs.472225. |
3D structure databases | |
| ProteinModelPortal | Q9NVP4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NVP4. 1 interaction. |
| MINT | MINT-2874146. |
PTM databases | |
| PhosphoSite | Q9NVP4. |
Polymorphism databases | |
| DMDM | 25090013. |
Proteomic databases | |
| PRIDE | Q9NVP4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262547; ENSP00000262547; ENSG00000089091. ENST00000357236; ENSP00000349774; ENSG00000089091. |
| GeneID | 55184. |
| KEGG | hsa:55184. |
| UCSC | uc002wqs.2. human. |
Organism-specific databases | |
| CTD | 55184. |
| GeneCards | GC20M018312. |
| HGNC | HGNC:15858. DZANK1. |
| neXtProt | NX_Q9NVP4. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11834. |
| GeneTree | ENSGT00390000000549. |
| HOVERGEN | HBG063313. |
| OMA | ITVAVMN. |
Gene expression databases | |
| ArrayExpress | Q9NVP4. |
| Bgee | Q9NVP4. |
| CleanEx | HS_C20orf12. |
| Genevestigator | Q9NVP4. |
| GermOnline | ENSG00000089091. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001876. Znf_RanBP2. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. |
| Pfam | PF12796. Ank_2. 1 hit. [Graphical view] |
| SMART | SM00248. ANK. 2 hits. SM00547. ZnF_RBZ. 2 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 59019. |
Entry information
| Entry name | DZAN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVP4 Secondary accession number(s): B7ZLZ4 Q9H442 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with