Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NVN3

- RIC8B_HUMAN

UniProt

Q9NVN3 - RIC8B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Synembryn-B

Gene

RIC8B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.By similarity

GO - Molecular functioni

  1. G-protein alpha-subunit binding Source: MGI
  2. guanyl-nucleotide exchange factor activity Source: UniProtKB-KW

GO - Biological processi

  1. regulation of G-protein coupled receptor protein signaling pathway Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Synembryn-B
Alternative name(s):
Brain synembryn
Short name:
hSyn
Protein Ric-8B
Gene namesi
Name:RIC8B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:25555. RIC8B.

Subcellular locationi

Cytoplasmcell cortex 1 Publication
Note: Localizes to the cell cortex.

GO - Cellular componenti

  1. centrosome Source: HPA
  2. cytoplasm Source: HPA
  3. cytosol Source: MGI
  4. plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671064.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 520520Synembryn-BPRO_0000235899Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei468 – 4681Phosphoserine1 Publication
Modified residuei473 – 4731Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NVN3.
PaxDbiQ9NVN3.
PRIDEiQ9NVN3.

PTM databases

PhosphoSiteiQ9NVN3.

Expressioni

Gene expression databases

BgeeiQ9NVN3.
CleanExiHS_RIC8B.
ExpressionAtlasiQ9NVN3. baseline and differential.
GenevestigatoriQ9NVN3.

Organism-specific databases

HPAiHPA042746.

Interactioni

Subunit structurei

Interacts with GDP-bound G alpha proteins GNAI1, GNAL, GNAS and GNAQ. Does not interact with G-alpha proteins when they are in complex with subunits beta and gamma.1 Publication

Protein-protein interaction databases

BioGridi120486. 12 interactions.
MINTiMINT-262340.
STRINGi9606.ENSP00000376583.

Structurei

3D structure databases

ProteinModelPortaliQ9NVN3.
SMRiQ9NVN3. Positions 113-148.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the synembryn family.Curated

Phylogenomic databases

eggNOGiNOG322219.
GeneTreeiENSGT00390000014700.
HOGENOMiHOG000236345.
HOVERGENiHBG054867.
InParanoidiQ9NVN3.
PhylomeDBiQ9NVN3.
TreeFamiTF314907.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR019318. Gua_nucleotide_exch_fac_Ric8.
IPR008376. Synembryn.
[Graphical view]
PfamiPF10165. Ric8. 1 hit.
[Graphical view]
PRINTSiPR01802. SYNEMBRYN.
SUPFAMiSSF48371. SSF48371. 2 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 5 (identifier: Q9NVN3-5) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEERALYIV RAGEAGAIER VLRDYSDKHR ATFKFESTDE DKRKKLCEGI
60 70 80 90 100
FKVLIKDIPT TCQVSCLEVL RILSRDKKVL VPVTTKENMQ ILLRLAKLNE
110 120 130 140 150
LDDSLEKVSE FPVIVESLKC LCNIVFNSQM AQQLSLELNL AAKLCNLLRK
160 170 180 190 200
CKDRKFINDI KCFDLRLLFL LSLLHTDIRS QLRYELQGLP LLTQILESAF
210 220 230 240 250
SIKWTDEYES AIDHNGPPLS PQETDCAIEA LKALFNVTVD SWKVHKESDS
260 270 280 290 300
HQFRVMAAVL RHCLLIVGPT EDKTEELHSN AVNLLSNVPV SCLDVLICPL
310 320 330 340 350
THEETAQEAT TLDELPSNKT AEKETVLKNN TMVYNGMNME AIHVLLNFME
360 370 380 390 400
KRIDKGSSYR EGLTPVLSLL TECSRAHRNI RKFLKDQVLP PLRDVTNRPE
410 420 430 440 450
VGSTVRNKLV RLMTHVDLGV KQIAAEFLFV LCKERVDSLL KYTGYGNAAG
460 470 480 490 500
LLAARGLLAG GRGDNWYSED EDTDTEEYKN AKPKEELLKP MGLKPDGTIT
510 520
PLEEALNQYS VIEETSSDTD
Length:520
Mass (Da):58,825
Last modified:October 5, 2010 - v2
Checksum:iC4D6B01725E6FB22
GO
Isoform 1 (identifier: Q9NVN3-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:536
Mass (Da):60,840
Checksum:i33630BB5FC93B65A
GO
Isoform 3 (identifier: Q9NVN3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRK → MLAS
     484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG

Note: No experimental confirmation available.

Show »
Length:496
Mass (Da):56,057
Checksum:i43D03EB653E815DC
GO
Isoform 4 (identifier: Q9NVN3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-240: Missing.
     241-247: SWKVHKE → MLSKLEK
     484-520: KEELLKPMGLKPDGTITPLEEALNQYSVIEETSSDTD → NSIEFEERSHLSRGK

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:258
Mass (Da):28,953
Checksum:i076D3D9809C4FE30
GO

Sequence cautioni

The sequence AAO65923.1 differs from that shown. Reason: Intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti201 – 2011S → T in AAO65923. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 240240Missing in isoform 4. 1 PublicationVSP_018510Add
BLAST
Alternative sequencei1 – 4444MDEER…EDKRK → MLAS in isoform 3. 1 PublicationVSP_018511Add
BLAST
Alternative sequencei241 – 2477SWKVHKE → MLSKLEK in isoform 4. 1 PublicationVSP_018512
Alternative sequencei484 – 52037KEELL…SSDTD → NINLITGHLEEPMPNPIDEM TEEQKEYEAMKLVNMLDKLS RRADVKDLHQDGG in isoform 1 and isoform 3. 3 PublicationsVSP_039866Add
BLAST
Alternative sequencei484 – 52037KEELL…SSDTD → NSIEFEERSHLSRGK in isoform 4. 1 PublicationVSP_018513Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001482 mRNA. Translation: BAA91717.1.
AK128102 mRNA. No translation available.
AC007695 Genomic DNA. No translation available.
AC079385 Genomic DNA. No translation available.
AC090011 Genomic DNA. No translation available.
BC034220 mRNA. Translation: AAH34220.1.
BC132689 mRNA. Translation: AAI32690.1.
BC144056 mRNA. Translation: AAI44057.1.
AY221116 mRNA. Translation: AAO65923.1. Sequence problems.
CCDSiCCDS9109.2. [Q9NVN3-5]
RefSeqiNP_060627.2. NM_018157.2. [Q9NVN3-5]
XP_005269056.1. XM_005268999.1. [Q9NVN3-1]
UniGeneiHs.131306.

Genome annotation databases

EnsembliENST00000355478; ENSP00000347662; ENSG00000111785. [Q9NVN3-3]
ENST00000392839; ENSP00000376583; ENSG00000111785. [Q9NVN3-5]
ENST00000462949; ENSP00000435301; ENSG00000111785. [Q9NVN3-1]
ENST00000470960; ENSP00000436359; ENSG00000111785. [Q9NVN3-4]
GeneIDi55188.
KEGGihsa:55188.
UCSCiuc001tlw.3. human. [Q9NVN3-1]
uc001tlx.3. human. [Q9NVN3-5]
uc001tly.3. human. [Q9NVN3-3]

Polymorphism databases

DMDMi308153488.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001482 mRNA. Translation: BAA91717.1 .
AK128102 mRNA. No translation available.
AC007695 Genomic DNA. No translation available.
AC079385 Genomic DNA. No translation available.
AC090011 Genomic DNA. No translation available.
BC034220 mRNA. Translation: AAH34220.1 .
BC132689 mRNA. Translation: AAI32690.1 .
BC144056 mRNA. Translation: AAI44057.1 .
AY221116 mRNA. Translation: AAO65923.1 . Sequence problems.
CCDSi CCDS9109.2. [Q9NVN3-5 ]
RefSeqi NP_060627.2. NM_018157.2. [Q9NVN3-5 ]
XP_005269056.1. XM_005268999.1. [Q9NVN3-1 ]
UniGenei Hs.131306.

3D structure databases

ProteinModelPortali Q9NVN3.
SMRi Q9NVN3. Positions 113-148.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120486. 12 interactions.
MINTi MINT-262340.
STRINGi 9606.ENSP00000376583.

PTM databases

PhosphoSitei Q9NVN3.

Polymorphism databases

DMDMi 308153488.

Proteomic databases

MaxQBi Q9NVN3.
PaxDbi Q9NVN3.
PRIDEi Q9NVN3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000355478 ; ENSP00000347662 ; ENSG00000111785 . [Q9NVN3-3 ]
ENST00000392839 ; ENSP00000376583 ; ENSG00000111785 . [Q9NVN3-5 ]
ENST00000462949 ; ENSP00000435301 ; ENSG00000111785 . [Q9NVN3-1 ]
ENST00000470960 ; ENSP00000436359 ; ENSG00000111785 . [Q9NVN3-4 ]
GeneIDi 55188.
KEGGi hsa:55188.
UCSCi uc001tlw.3. human. [Q9NVN3-1 ]
uc001tlx.3. human. [Q9NVN3-5 ]
uc001tly.3. human. [Q9NVN3-3 ]

Organism-specific databases

CTDi 55188.
GeneCardsi GC12P107168.
HGNCi HGNC:25555. RIC8B.
HPAi HPA042746.
MIMi 609147. gene.
neXtProti NX_Q9NVN3.
PharmGKBi PA142671064.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG322219.
GeneTreei ENSGT00390000014700.
HOGENOMi HOG000236345.
HOVERGENi HBG054867.
InParanoidi Q9NVN3.
PhylomeDBi Q9NVN3.
TreeFami TF314907.

Miscellaneous databases

GenomeRNAii 55188.
NextBioi 59035.
PROi Q9NVN3.
SOURCEi Search...

Gene expression databases

Bgeei Q9NVN3.
CleanExi HS_RIC8B.
ExpressionAtlasi Q9NVN3. baseline and differential.
Genevestigatori Q9NVN3.

Family and domain databases

Gene3Di 1.25.10.10. 1 hit.
InterProi IPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR019318. Gua_nucleotide_exch_fac_Ric8.
IPR008376. Synembryn.
[Graphical view ]
Pfami PF10165. Ric8. 1 hit.
[Graphical view ]
PRINTSi PR01802. SYNEMBRYN.
SUPFAMi SSF48371. SSF48371. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Teratocarcinoma and Testis.
  2. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
    Tissue: Brain.
  4. "Human brain synembryn interacts with Gsalpha and Gqalpha and is translocated to the plasma membrane in response to isoproterenol and carbachol."
    Klattenhoff C., Montecino M., Soto X., Guzman L., Romo X., Garcia M.A., Mellstrom B., Naranjo J.R., Hinrichs M.V., Olate J.
    J. Cell. Physiol. 195:151-157(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 23-483 (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH GNAS AND GNAQ.
    Tissue: Brain.
  5. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468 AND THR-473, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiRIC8B_HUMAN
AccessioniPrimary (citable) accession number: Q9NVN3
Secondary accession number(s): A2RTZ0
, Q4G103, Q6ZRN4, Q86WD3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 5, 2010
Last modified: November 26, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3