Q9NVN3 (RIC8B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Synembryn-B Alternative name(s): Brain synembrin Short name=hSyn Protein Ric-8B | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 520 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP By similarity. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction By similarity. |
| Subunit structure | Interacts with GDP-bound G alpha proteins GNAI1, GNAL, GNAS and GNAQ. Does not interact with G-alpha proteins when they are in complex with subunits beta and gamma. Ref.4 |
| Subcellular location | Cytoplasm › cell cortex. Note: Localizes to the cell cortex. Ref.4 |
| Sequence similarities | Belongs to the synembryn family. |
| Sequence caution | The sequence AAO65923.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Guanine-nucleotide releasing factor |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of G-protein coupled receptor protein signaling pathway Inferred from direct assay Ref.4. Source: MGI |
| Cellular_component | cell cortex Inferred from electronic annotation. Source: UniProtKB-SubCell centrosomeInferred from direct assay. Source: HPA cytosolInferred from direct assay Ref.4. Source: MGI plasma membraneInferred from direct assay Ref.4. Source: MGI |
| Molecular_function | G-protein alpha-subunit binding Inferred from direct assay Ref.4. Source: MGI guanyl-nucleotide exchange factor activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 5 (identifier: Q9NVN3-5) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9NVN3-1) The sequence of this isoform differs from the canonical sequence as follows: 484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q9NVN3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-44: MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRK → MLAS 484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9NVN3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-240: Missing. 241-247: SWKVHKE → MLSKLEK 484-520: KEELLKPMGLKPDGTITPLEEALNQYSVIEETSSDTD → NSIEFEERSHLSRGK | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 520 | 520 | Synembryn-B | PRO_0000235899 | |||||
Amino acid modifications | |||||||||
| Modified residue | 468 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 473 | 1 | Phosphothreonine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 240 | 240 | Missing in isoform 4. | VSP_018510 | |||||
| Alternative sequence | 1 – 44 | 44 | MDEER…EDKRK → MLAS in isoform 3. | VSP_018511 | |||||
| Alternative sequence | 241 – 247 | 7 | SWKVHKE → MLSKLEK in isoform 4. | VSP_018512 | |||||
| Alternative sequence | 484 – 520 | 37 | KEELL…SSDTD → NINLITGHLEEPMPNPIDEM TEEQKEYEAMKLVNMLDKLS RRADVKDLHQDGG in isoform 1 and isoform 3. | VSP_039866 | |||||
| Alternative sequence | 484 – 520 | 37 | KEELL…SSDTD → NSIEFEERSHLSRGK in isoform 4. | VSP_018513 | |||||
Experimental info | |||||||||
| Sequence conflict | 201 | 1 | S → T in AAO65923. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Tissue: Teratocarcinoma and Testis. |
| [2] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5). Tissue: Brain. |
| [4] | "Human brain synembryn interacts with Gsalpha and Gqalpha and is translocated to the plasma membrane in response to isoproterenol and carbachol." Klattenhoff C., Montecino M., Soto X., Guzman L., Romo X., Garcia M.A., Mellstrom B., Naranjo J.R., Hinrichs M.V., Olate J. J. Cell. Physiol. 195:151-157(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 23-483 (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH GNAS AND GNAQ. Tissue: Brain. |
| [5] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468 AND THR-473, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK001482 mRNA. Translation: BAA91717.1. AK128102 mRNA. No translation available. AC007695 Genomic DNA. No translation available. AC079385 Genomic DNA. No translation available. AC090011 Genomic DNA. No translation available. BC034220 mRNA. Translation: AAH34220.1. BC132689 mRNA. Translation: AAI32690.1. BC144056 mRNA. Translation: AAI44057.1. AY221116 mRNA. Translation: AAO65923.1. Sequence problems. |
| IPI | IPI00018771. IPI00443951. IPI00746112. IPI00853186. |
| RefSeq | NP_060627.2. NM_018157.2. |
| UniGene | Hs.131306. |
3D structure databases | |
| ProteinModelPortal | Q9NVN3. |
| SMR | Q9NVN3. Positions 409-434. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000376583. |
PTM databases | |
| PhosphoSite | Q9NVN3. |
Polymorphism databases | |
| DMDM | 308153488. |
Proteomic databases | |
| PaxDb | Q9NVN3. |
| PRIDE | Q9NVN3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355478; ENSP00000347662; ENSG00000111785. ENST00000392839; ENSP00000376583; ENSG00000111785. ENST00000462949; ENSP00000435301; ENSG00000111785. ENST00000470960; ENSP00000436359; ENSG00000111785. |
| GeneID | 55188. |
| KEGG | hsa:55188. |
| UCSC | uc001tlw.3. human. uc001tlx.3. human. uc001tly.3. human. |
Organism-specific databases | |
| CTD | 55188. |
| GeneCards | GC12P107168. |
| HGNC | HGNC:25555. RIC8B. |
| HPA | HPA042746. |
| MIM | 609147. gene. |
| neXtProt | NX_Q9NVN3. |
| PharmGKB | PA142671064. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG322219. |
| HOGENOM | HOG000236345. |
| HOVERGEN | HBG054867. |
Gene expression databases | |
| ArrayExpress | Q9NVN3. |
| Bgee | Q9NVN3. |
| CleanEx | HS_RIC8B. |
| Genevestigator | Q9NVN3. |
| GermOnline | ENSG00000111785. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 1 hit. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR019318. Gua_nucleotide_exch_fac_Ric8. IPR008376. Synembryn. [Graphical view] |
| Pfam | PF10165. Ric8. 1 hit. [Graphical view] |
| PRINTS | PR01802. SYNEMBRYN. |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55188. |
| NextBio | 59035. |
| SOURCE | Search... |
Entry information
| Entry name | RIC8B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVN3 Secondary accession number(s): A2RTZ0 Q86WD3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
