Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NVN3

- RIC8B_HUMAN

UniProt

Q9NVN3 - RIC8B_HUMAN

Protein

Synembryn-B

Gene

RIC8B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 2 (05 Oct 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.By similarity

    GO - Molecular functioni

    1. G-protein alpha-subunit binding Source: MGI
    2. guanyl-nucleotide exchange factor activity Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of G-protein coupled receptor protein signaling pathway Source: MGI

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Synembryn-B
    Alternative name(s):
    Brain synembryn
    Short name:
    hSyn
    Protein Ric-8B
    Gene namesi
    Name:RIC8B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:25555. RIC8B.

    Subcellular locationi

    Cytoplasmcell cortex 1 Publication
    Note: Localizes to the cell cortex.

    GO - Cellular componenti

    1. cell cortex Source: UniProtKB-SubCell
    2. centrosome Source: HPA
    3. cytoplasm Source: HPA
    4. cytosol Source: MGI
    5. plasma membrane Source: MGI

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671064.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 520520Synembryn-BPRO_0000235899Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei468 – 4681Phosphoserine1 Publication
    Modified residuei473 – 4731Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9NVN3.
    PaxDbiQ9NVN3.
    PRIDEiQ9NVN3.

    PTM databases

    PhosphoSiteiQ9NVN3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NVN3.
    BgeeiQ9NVN3.
    CleanExiHS_RIC8B.
    GenevestigatoriQ9NVN3.

    Organism-specific databases

    HPAiHPA042746.

    Interactioni

    Subunit structurei

    Interacts with GDP-bound G alpha proteins GNAI1, GNAL, GNAS and GNAQ. Does not interact with G-alpha proteins when they are in complex with subunits beta and gamma.1 Publication

    Protein-protein interaction databases

    BioGridi120486. 1 interaction.
    MINTiMINT-262340.
    STRINGi9606.ENSP00000376583.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NVN3.
    SMRiQ9NVN3. Positions 406-432.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the synembryn family.Curated

    Phylogenomic databases

    eggNOGiNOG322219.
    HOGENOMiHOG000236345.
    HOVERGENiHBG054867.
    PhylomeDBiQ9NVN3.
    TreeFamiTF314907.

    Family and domain databases

    Gene3Di1.25.10.10. 1 hit.
    InterProiIPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR019318. Gua_nucleotide_exch_fac_Ric8.
    IPR008376. Synembryn.
    [Graphical view]
    PfamiPF10165. Ric8. 1 hit.
    [Graphical view]
    PRINTSiPR01802. SYNEMBRYN.
    SUPFAMiSSF48371. SSF48371. 2 hits.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 5 (identifier: Q9NVN3-5) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDEERALYIV RAGEAGAIER VLRDYSDKHR ATFKFESTDE DKRKKLCEGI    50
    FKVLIKDIPT TCQVSCLEVL RILSRDKKVL VPVTTKENMQ ILLRLAKLNE 100
    LDDSLEKVSE FPVIVESLKC LCNIVFNSQM AQQLSLELNL AAKLCNLLRK 150
    CKDRKFINDI KCFDLRLLFL LSLLHTDIRS QLRYELQGLP LLTQILESAF 200
    SIKWTDEYES AIDHNGPPLS PQETDCAIEA LKALFNVTVD SWKVHKESDS 250
    HQFRVMAAVL RHCLLIVGPT EDKTEELHSN AVNLLSNVPV SCLDVLICPL 300
    THEETAQEAT TLDELPSNKT AEKETVLKNN TMVYNGMNME AIHVLLNFME 350
    KRIDKGSSYR EGLTPVLSLL TECSRAHRNI RKFLKDQVLP PLRDVTNRPE 400
    VGSTVRNKLV RLMTHVDLGV KQIAAEFLFV LCKERVDSLL KYTGYGNAAG 450
    LLAARGLLAG GRGDNWYSED EDTDTEEYKN AKPKEELLKP MGLKPDGTIT 500
    PLEEALNQYS VIEETSSDTD 520
    Length:520
    Mass (Da):58,825
    Last modified:October 5, 2010 - v2
    Checksum:iC4D6B01725E6FB22
    GO
    Isoform 1 (identifier: Q9NVN3-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:536
    Mass (Da):60,840
    Checksum:i33630BB5FC93B65A
    GO
    Isoform 3 (identifier: Q9NVN3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRK → MLAS
         484-520: KEELLKPMGL...VIEETSSDTD → NINLITGHLE...DVKDLHQDGG

    Note: No experimental confirmation available.

    Show »
    Length:496
    Mass (Da):56,057
    Checksum:i43D03EB653E815DC
    GO
    Isoform 4 (identifier: Q9NVN3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-240: Missing.
         241-247: SWKVHKE → MLSKLEK
         484-520: KEELLKPMGLKPDGTITPLEEALNQYSVIEETSSDTD → NSIEFEERSHLSRGK

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:258
    Mass (Da):28,953
    Checksum:i076D3D9809C4FE30
    GO

    Sequence cautioni

    The sequence AAO65923.1 differs from that shown. Reason: Intron retention.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti201 – 2011S → T in AAO65923. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 240240Missing in isoform 4. 1 PublicationVSP_018510Add
    BLAST
    Alternative sequencei1 – 4444MDEER…EDKRK → MLAS in isoform 3. 1 PublicationVSP_018511Add
    BLAST
    Alternative sequencei241 – 2477SWKVHKE → MLSKLEK in isoform 4. 1 PublicationVSP_018512
    Alternative sequencei484 – 52037KEELL…SSDTD → NINLITGHLEEPMPNPIDEM TEEQKEYEAMKLVNMLDKLS RRADVKDLHQDGG in isoform 1 and isoform 3. 3 PublicationsVSP_039866Add
    BLAST
    Alternative sequencei484 – 52037KEELL…SSDTD → NSIEFEERSHLSRGK in isoform 4. 1 PublicationVSP_018513Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001482 mRNA. Translation: BAA91717.1.
    AK128102 mRNA. No translation available.
    AC007695 Genomic DNA. No translation available.
    AC079385 Genomic DNA. No translation available.
    AC090011 Genomic DNA. No translation available.
    BC034220 mRNA. Translation: AAH34220.1.
    BC132689 mRNA. Translation: AAI32690.1.
    BC144056 mRNA. Translation: AAI44057.1.
    AY221116 mRNA. Translation: AAO65923.1. Sequence problems.
    CCDSiCCDS9109.2. [Q9NVN3-5]
    RefSeqiNP_060627.2. NM_018157.2. [Q9NVN3-5]
    XP_005269056.1. XM_005268999.1. [Q9NVN3-1]
    UniGeneiHs.131306.

    Genome annotation databases

    EnsembliENST00000355478; ENSP00000347662; ENSG00000111785. [Q9NVN3-3]
    ENST00000392839; ENSP00000376583; ENSG00000111785. [Q9NVN3-5]
    ENST00000462949; ENSP00000435301; ENSG00000111785. [Q9NVN3-1]
    ENST00000470960; ENSP00000436359; ENSG00000111785. [Q9NVN3-4]
    GeneIDi55188.
    KEGGihsa:55188.
    UCSCiuc001tlw.3. human. [Q9NVN3-1]
    uc001tlx.3. human. [Q9NVN3-5]
    uc001tly.3. human. [Q9NVN3-3]

    Polymorphism databases

    DMDMi308153488.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK001482 mRNA. Translation: BAA91717.1 .
    AK128102 mRNA. No translation available.
    AC007695 Genomic DNA. No translation available.
    AC079385 Genomic DNA. No translation available.
    AC090011 Genomic DNA. No translation available.
    BC034220 mRNA. Translation: AAH34220.1 .
    BC132689 mRNA. Translation: AAI32690.1 .
    BC144056 mRNA. Translation: AAI44057.1 .
    AY221116 mRNA. Translation: AAO65923.1 . Sequence problems.
    CCDSi CCDS9109.2. [Q9NVN3-5 ]
    RefSeqi NP_060627.2. NM_018157.2. [Q9NVN3-5 ]
    XP_005269056.1. XM_005268999.1. [Q9NVN3-1 ]
    UniGenei Hs.131306.

    3D structure databases

    ProteinModelPortali Q9NVN3.
    SMRi Q9NVN3. Positions 406-432.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120486. 1 interaction.
    MINTi MINT-262340.
    STRINGi 9606.ENSP00000376583.

    PTM databases

    PhosphoSitei Q9NVN3.

    Polymorphism databases

    DMDMi 308153488.

    Proteomic databases

    MaxQBi Q9NVN3.
    PaxDbi Q9NVN3.
    PRIDEi Q9NVN3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000355478 ; ENSP00000347662 ; ENSG00000111785 . [Q9NVN3-3 ]
    ENST00000392839 ; ENSP00000376583 ; ENSG00000111785 . [Q9NVN3-5 ]
    ENST00000462949 ; ENSP00000435301 ; ENSG00000111785 . [Q9NVN3-1 ]
    ENST00000470960 ; ENSP00000436359 ; ENSG00000111785 . [Q9NVN3-4 ]
    GeneIDi 55188.
    KEGGi hsa:55188.
    UCSCi uc001tlw.3. human. [Q9NVN3-1 ]
    uc001tlx.3. human. [Q9NVN3-5 ]
    uc001tly.3. human. [Q9NVN3-3 ]

    Organism-specific databases

    CTDi 55188.
    GeneCardsi GC12P107168.
    HGNCi HGNC:25555. RIC8B.
    HPAi HPA042746.
    MIMi 609147. gene.
    neXtProti NX_Q9NVN3.
    PharmGKBi PA142671064.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG322219.
    HOGENOMi HOG000236345.
    HOVERGENi HBG054867.
    PhylomeDBi Q9NVN3.
    TreeFami TF314907.

    Miscellaneous databases

    GenomeRNAii 55188.
    NextBioi 59035.
    PROi Q9NVN3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NVN3.
    Bgeei Q9NVN3.
    CleanExi HS_RIC8B.
    Genevestigatori Q9NVN3.

    Family and domain databases

    Gene3Di 1.25.10.10. 1 hit.
    InterProi IPR011989. ARM-like.
    IPR016024. ARM-type_fold.
    IPR019318. Gua_nucleotide_exch_fac_Ric8.
    IPR008376. Synembryn.
    [Graphical view ]
    Pfami PF10165. Ric8. 1 hit.
    [Graphical view ]
    PRINTSi PR01802. SYNEMBRYN.
    SUPFAMi SSF48371. SSF48371. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
      Tissue: Teratocarcinoma and Testis.
    2. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
      Tissue: Brain.
    4. "Human brain synembryn interacts with Gsalpha and Gqalpha and is translocated to the plasma membrane in response to isoproterenol and carbachol."
      Klattenhoff C., Montecino M., Soto X., Guzman L., Romo X., Garcia M.A., Mellstrom B., Naranjo J.R., Hinrichs M.V., Olate J.
      J. Cell. Physiol. 195:151-157(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 23-483 (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH GNAS AND GNAQ.
      Tissue: Brain.
    5. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468 AND THR-473, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiRIC8B_HUMAN
    AccessioniPrimary (citable) accession number: Q9NVN3
    Secondary accession number(s): A2RTZ0
    , Q4G103, Q6ZRN4, Q86WD3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 16, 2006
    Last sequence update: October 5, 2010
    Last modified: October 1, 2014
    This is version 91 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3