Q9NVH6 (TMLH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Trimethyllysine dioxygenase, mitochondrial EC=1.14.11.8 Alternative name(s): Epsilon-trimethyllysine 2-oxoglutarate dioxygenase Epsilon-trimethyllysine hydroxylase TML hydroxylase TML-alpha-ketoglutarate dioxygenase Short name=TML dioxygenase Short name=TMLD | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 421 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML). |
| Catalytic activity | N6,N6,N(6)-trimethyl-L-lysine + 2-oxoglutarate + O2 = 3-hydroxy-N6,N6,N(6)-trimethyl-L-lysine + succinate + CO2. |
| Cofactor | Binds 1 Fe2+ ion per subunit By similarity. Ascorbate. |
| Pathway | |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | |
| Tissue specificity | All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle. Ref.7 Ref.8 |
| Involvement in disease | Epsilon-trimethyllysine hydroxylase deficiency (TMLHED) [MIM:300872]: An inborn error of carnitine biosynthesis associated with an increased risk for developing autistic behavior. Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. |
| Sequence similarities | Belongs to the gamma-BBH/TMLD family. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NVH6-1) Also known as: TMLHa; TMLH1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NVH6-3) Also known as: TMLHb; The sequence of this isoform differs from the canonical sequence as follows: 333-421: YNNYDRAVIN...NTARLLGLQA → VLRSWCSTRT...PWLSGVFYTI | ||||||
| Note: Produced by alternative splicing. Lacks enzymatic activity. | ||||||
| Isoform 3 (identifier: Q9NVH6-4) Also known as: TMLHc; The sequence of this isoform differs from the canonical sequence as follows: 333-421: Missing. | ||||||
| Note: Produced by alternative splicing. Lacks enzymatic activity. | ||||||
| Isoform 4 (identifier: Q9NVH6-2) Also known as: TMLHd; The sequence of this isoform differs from the canonical sequence as follows: 333-421: YNNYDRAVIN...NTARLLGLQA → LFKEKQNTVN...TSIEHRGSLI | ||||||
| Note: Produced by alternative splicing. Lacks enzymatic activity. | ||||||
| Isoform 5 (identifier: Q9NVH6-5) Also known as: TMLHe; The sequence of this isoform differs from the canonical sequence as follows: 380-383: LFID → GPN 384-421: Missing. | ||||||
| Note: Produced by alternative splicing. Lacks enzymatic activity. | ||||||
| Isoform 6 (identifier: Q9NVH6-6) Also known as: TMLHf; The sequence of this isoform differs from the canonical sequence as follows: 61-120: ELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTW → G | ||||||
| Note: Produced by alternative splicing. Lacks the mitochondrial transit signal. | ||||||
| Isoform 7 (identifier: Q9NVH6-7) Also known as: TMLHg; The sequence of this isoform differs from the canonical sequence as follows: 1-68: Missing. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 8 (identifier: Q9NVH6-8) Also known as: TMLH1b; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKIDSFLPILRM | ||||||
| Note: Produced by alternative promoter usage. Although the expression of the alternative 5' exon has been detected by PCR in heart and skeletal muscle, the identification of the alternative promoter leading to this form remains elusive (PubMed:17408883). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 15 | 15 | Mitochondrion | ||||||
| Chain | 16 – 421 | 406 | Trimethyllysine dioxygenase, mitochondrial | PRO_0000002795 | |||||
Sites | |||||||||
| Metal binding | 242 | 1 | Iron; catalytic By similarity | ||||||
| Metal binding | 244 | 1 | Iron; catalytic By similarity | ||||||
| Metal binding | 389 | 1 | Iron; catalytic By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 236 | 1 | N6-acetyllysine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 68 | 68 | Missing in isoform 7. | VSP_042275 | |||||
| Alternative sequence | 1 | 1 | M → MKIDSFLPILRM in isoform 8. | VSP_042276 | |||||
| Alternative sequence | 61 – 120 | 60 | ELKYA…LFFTW → G in isoform 6. | VSP_042277 | |||||
| Alternative sequence | 333 – 421 | 89 | YNNYD…LGLQA → VLRSWCSTRTIEATSKEIKL YIVCRYSYFGETLFPRSKET VTSLPHMCAYKAAATNRPWL SGVFYTI in isoform 2. | VSP_042278 | |||||
| Alternative sequence | 333 – 421 | 89 | Missing in isoform 3. | VSP_042279 | |||||
| Alternative sequence | 333 – 421 | 89 | YNNYD…LGLQA → LFKEKQNTVNRQWNSSLQCD IPERILTYRHFVSGTSIEHR GSLI in isoform 4. | VSP_021579 | |||||
| Alternative sequence | 380 – 383 | 4 | LFID → GPN in isoform 5. | VSP_042280 | |||||
| Alternative sequence | 384 – 421 | 38 | Missing in isoform 5. | VSP_042281 | |||||
Experimental info | |||||||||
| Mutagenesis | 389 | 1 | H → L: No catalytic activity. Ref.7 | ||||||
| Sequence conflict | 66 | 1 | N → D in CAG33546. Ref.3 | ||||||
| Sequence conflict | 170 | 1 | F → S in BAF84383. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular and biochemical characterization of rat epsilon-N-trimethyllysine hydroxylase, the first enzyme of carnitine biosynthesis." Vaz F.M., Ofman R., Westinga K., Back J.W., Wanders R.J.A. J. Biol. Chem. 276:33512-33517(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 66-332 (ISOFORM 3). Tissue: Placenta, Teratocarcinoma, Thymus and Uterus. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Pancreas. |
| [7] | "Functional analysis of TMLH variants and definition of domains required for catalytic activity and mitochondrial targeting." Monfregola J., Cevenini A., Terracciano A., van Vlies N., Arbucci S., Wanders R.J., D'Urso M., Vaz F.M., Ursini M.V. J. Cell. Physiol. 204:839-847(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION, TRANSIT PEPTIDE, MUTAGENESIS OF HIS-389, ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). |
| [8] | "Functional characterization of the TMLH gene: promoter analysis, in situ hybridization, identification and mapping of alternative splicing variants." Monfregola J., Napolitano G., Conte I., Cevenini A., Migliaccio C., D'Urso M., Ursini M.V. Gene 395:86-97(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [9] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-236, MASS SPECTROMETRY. |
| [10] | "Use of array CGH to detect exonic copy number variants throughout the genome in autism families detects a novel deletion in TMLHE." Celestino-Soper P.B., Shaw C.A., Sanders S.J., Li J., Murtha M.T., Ercan-Sencicek A.G., Davis L., Thomson S., Gambin T., Chinault A.C., Ou Z., German J.R., Milosavljevic A., Sutcliffe J.S., Cook E.H. Jr., Stankiewicz P., State M.W., Beaudet A.L. Hum. Mol. Genet. 20:4360-4370(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN TMLHED. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF373407 mRNA. Translation: AAL01871.1. AK001589 mRNA. Translation: BAA91775.1. AK291694 mRNA. Translation: BAF84383.1. AK304830 mRNA. Translation: BAG65575.1. AK310667 mRNA. No translation available. CR457265 mRNA. Translation: CAG33546.1. AM393196 mRNA. Translation: CAL38074.1. BX276110 Genomic DNA. Translation: CAH71441.1. BX276110 Genomic DNA. Translation: CAH71442.1. BC025269 mRNA. Translation: AAH25269.1. |
| IPI | IPI00301224. IPI00382858. |
| RefSeq | NP_001171726.1. NM_001184797.1. NP_060666.1. NM_018196.3. |
| UniGene | Hs.133321. |
3D structure databases | |
| ProteinModelPortal | Q9NVH6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NVH6. 5 interactions. |
| STRING | 9606.ENSP00000335261. |
PTM databases | |
| PhosphoSite | Q9NVH6. |
Polymorphism databases | |
| DMDM | 21542295. |
Proteomic databases | |
| PaxDb | Q9NVH6. |
| PRIDE | Q9NVH6. |
Protocols and materials databases | |
| DNASU | 55217. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000334398; ENSP00000335261; ENSG00000185973. ENST00000369439; ENSP00000358447; ENSG00000185973. ENST00000596345; ENSP00000469021; ENSG00000267946. ENST00000597729; ENSP00000470860; ENSG00000267946. |
| GeneID | 55217. |
| KEGG | hsa:55217. |
| UCSC | uc004fnn.3. human. uc004fnp.4. human. |
Organism-specific databases | |
| CTD | 55217. |
| GeneCards | GC0XM154719. |
| HGNC | HGNC:18308. TMLHE. |
| HPA | HPA034589. |
| MIM | 300777. gene. 300872. phenotype. |
| neXtProt | NX_Q9NVH6. |
| PharmGKB | PA38311. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2175. |
| HOGENOM | HOG000210004. |
| HOVERGEN | HBG035650. |
| InParanoid | Q9NVH6. |
| KO | K00474. |
| OMA | LCGCYLT. |
| OrthoDB | EOG4QRH4C. |
| PhylomeDB | Q9NVH6. |
Enzyme and pathway databases | |
| BRENDA | 1.14.11.8. 2681. |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00118. |
Gene expression databases | |
| Bgee | Q9NVH6. |
| CleanEx | HS_TMLHE. |
| Genevestigator | Q9NVH6. |
| GermOnline | ENSG00000185973. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR010376. DUF971. IPR003819. Taurine_dOase. IPR012776. Trimethyllysine_dOase. [Graphical view] |
| PANTHER | PTHR10696:SF2. PTHR10696:SF2. 1 hit. |
| Pfam | PF06155. DUF971. 1 hit. PF02668. TauD. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR02410. carnitine_TMLD. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00139. Succinic acid. DB00126. Vitamin C. |
| GenomeRNAi | 55217. |
| NextBio | 59184. |
| SOURCE | Search... |
Entry information
| Entry name | TMLH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVH6 Secondary accession number(s): A8K6M9 Q8TBT0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
