Q9NV58 (RN19A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase RNF19A EC=6.3.2.- Alternative name(s): Double ring-finger protein Short name=Dorfin RING finger protein 19A p38 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 838 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as SNCAIP or CASR. Specifically ubiquitinates pathogenic SOD1 variants, which leads to their proteasomal degradation and to neuronal protection. Ref.1 Ref.7 Ref.8 Ref.9 Ref.10 |
| Pathway | |
| Subunit structure | Interacts with UBE2L3 and UBE2L6. Interacts with transcription factor Sp1. Interacts with VCP, CASR, SNCAIP and with some SOD1 variants which cause amyotrophic lateral sclerosis, but not with wild-type SOD1. Ref.1 Ref.5 Ref.7 Ref.8 Ref.9 Ref.10 |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. Cytoplasm › cytoskeleton › centrosome. Note: Present in the hyaline inclusion bodies specifically found in motor neurons from amyotrophic lateral sclerosis patients. Present in the Lewy bodies specifically found in neurons from Parkinson disease patients. Ref.1 Ref.7 Ref.8 Ref.9 |
| Tissue specificity | Widely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system. Ref.1 |
| Sequence similarities | Belongs to the RBR family. RNF19 subfamily. Contains 1 IBR-type zinc finger. Contains 2 RING-type zinc fingers. |
| Sequence caution | The sequence BAB14581.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15647.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NV58-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NV58-2) The sequence of this isoform differs from the canonical sequence as follows: 572-604: RYSLSGESGTVSLGTVSDNASTKAMAGSILNSY → AAVAAAGRWAYSPATLRCRRSEELKNIHDSS 605-838: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NV58-3) The sequence of this isoform differs from the canonical sequence as follows: 1-31: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 838 | 838 | E3 ubiquitin-protein ligase RNF19A | PRO_0000056061 | |||||
Regions | |||||||||
| Transmembrane | 368 – 388 | 21 | Helical; Potential | ||||||
| Transmembrane | 424 – 444 | 21 | Helical; Potential | ||||||
| Zinc finger | 132 – 179 | 48 | RING-type 1 | ||||||
| Zinc finger | 199 – 264 | 66 | IBR-type | ||||||
| Zinc finger | 301 – 332 | 32 | RING-type 2 | ||||||
| Region | 660 – 838 | 179 | Interaction with CASR | ||||||
Amino acid modifications | |||||||||
| Modified residue | 631 | 1 | Phosphoserine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | Missing in isoform 3. | VSP_028631 | |||||
| Alternative sequence | 572 – 604 | 33 | RYSLS…ILNSY → AAVAAAGRWAYSPATLRCRR SEELKNIHDSS in isoform 2. | VSP_021010 | |||||
| Alternative sequence | 605 – 838 | 234 | Missing in isoform 2. | VSP_021011 | |||||
| Natural variant | 835 | 1 | Q → H. Corresponds to variant rs9642785 [ dbSNP | Ensembl ]. | VAR_028045 | |||||
Experimental info | |||||||||
| Mutagenesis | 132 | 1 | C → S: Abolishes interaction with VCP and E3 ligase activity toward mutant SOD1; when associated with S-135. Ref.9 | ||||||
| Mutagenesis | 135 | 1 | C → S: Abolishes interaction with VCP and E3 ligase activity toward mutant SOD1; when associated with S-132. Ref.9 | ||||||
| Sequence conflict | 645 | 1 | H → Y in BAB39353. Ref.1 | ||||||
| Sequence conflict | 744 | 1 | S → R in CAB53700. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity." Niwa J., Ishigaki S., Doyu M., Suzuki T., Tanaka K., Sobue G. Biochem. Biophys. Res. Commun. 281:706-713(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH UBE2L3 AND UBE2L6, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Spinal cord. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Expression and promoter activity of MaLR element of Dorfin gene related to Parkinson disease." Kim T., Huh J., Kim H. Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-89 (ISOFORM 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 426-838 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-838 (ISOFORM 2). Tissue: Hepatoma, Ovarian carcinoma and Placenta. |
| [5] | "A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening." Gunther M., Laithier M., Brison O. Mol. Cell. Biochem. 210:131-142(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 422-824 (ISOFORM 1), INTERACTION WITH SP1. Tissue: Colon. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 524-838 (ISOFORM 1). Tissue: Fetal kidney and Testis. |
| [7] | "Dorfin ubiquitylates mutant SOD1 and prevents mutant SOD1-mediated neurotoxicity." Niwa J., Ishigaki S., Hishikawa N., Yamamoto M., Doyu M., Murata S., Tanaka K., Taniguchi N., Sobue G. J. Biol. Chem. 277:36793-36798(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SOD1. |
| [8] | "Dorfin localizes to Lewy bodies and ubiquitylates synphilin-1." Ito T., Niwa J., Hishikawa N., Ishigaki S., Doyu M., Sobue G. J. Biol. Chem. 278:29106-29114(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SNCAIP. |
| [9] | "Physical and functional interaction between dorfin and valosin-containing protein that are colocalized in ubiquitylated inclusions in neurodegenerative disorders." Ishigaki S., Hishikawa N., Niwa J., Iemura S., Natsume T., Hori S., Kakizuka A., Tanaka K., Sobue G. J. Biol. Chem. 279:51376-51385(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH VCP, MUTAGENESIS OF CYS-132 AND CYS-135, SUBCELLULAR LOCATION. |
| [10] | "Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin." Huang Y., Niwa J., Sobue G., Breitwieser G.E. J. Biol. Chem. 281:11610-11617(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CASR AND VCP. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-631, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB029316 mRNA. Translation: BAB39353.1. BC093938 mRNA. Translation: AAH93938.1. BC093940 mRNA. Translation: AAH93940.1. AB271914 mRNA. Translation: BAF48117.1. AK001774 mRNA. Translation: BAA91900.1. AK023455 mRNA. Translation: BAB14581.1. Different initiation. AK027070 mRNA. Translation: BAB15647.1. Different initiation. AJ242975 mRNA. Translation: CAB45132.1. AL110253 mRNA. Translation: CAB53700.1. AL122096 mRNA. Translation: CAB59264.1. |
| IPI | IPI00019056. IPI00793570. IPI00869122. |
| PIR | T34528. |
| RefSeq | NP_056250.3. NM_015435.3. NP_904355.1. NM_183419.2. |
| UniGene | Hs.292882. |
3D structure databases | |
| ProteinModelPortal | Q9NV58. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NV58. 1 interaction. |
| STRING | 9606.ENSP00000342667. |
PTM databases | |
| PhosphoSite | Q9NV58. |
Polymorphism databases | |
| DMDM | 116242764. |
Proteomic databases | |
| PaxDb | Q9NV58. |
| PRIDE | Q9NV58. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000341084; ENSP00000342667; ENSG00000034677. ENST00000517584; ENSP00000429161; ENSG00000034677. ENST00000519449; ENSP00000428968; ENSG00000034677. |
| GeneID | 25897. |
| KEGG | hsa:25897. |
| UCSC | uc003yjj.1. human. |
Organism-specific databases | |
| CTD | 25897. |
| GeneCards | GC08M101269. |
| HGNC | HGNC:13432. RNF19A. |
| HPA | CAB011455. HPA023652. |
| MIM | 607119. gene. |
| neXtProt | NX_Q9NV58. |
| PharmGKB | PA162401601. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG245345. |
| HOVERGEN | HBG052073. |
| InParanoid | Q9NV58. |
| KO | K11972. |
| OMA | SNMKINE. |
| OrthoDB | EOG41JZBM. |
| PhylomeDB | Q9NV58. |
Enzyme and pathway databases | |
| UniPathway | UPA00143. |
Gene expression databases | |
| ArrayExpress | Q9NV58. |
| Bgee | Q9NV58. |
| CleanEx | HS_RNF19A. |
| Genevestigator | Q9NV58. |
| GermOnline | ENSG00000034677. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR002867. Znf_C6HC. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF01485. IBR. 2 hits. [Graphical view] |
| SMART | SM00647. IBR. 2 hits. SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RNF19A. human. |
| GenomeRNAi | 25897. |
| NextBio | 47345. |
| SOURCE | Search... |
Entry information
| Entry name | RN19A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NV58 Secondary accession number(s): A3KCU9 Q9Y4Y1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
