Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NV58

- RN19A_HUMAN

UniProt

Q9NV58 - RN19A_HUMAN

Protein

E3 ubiquitin-protein ligase RNF19A

Gene

RNF19A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 3 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as SNCAIP or CASR. Specifically ubiquitinates pathogenic SOD1 variants, which leads to their proteasomal degradation and to neuronal protection.5 Publications

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri132 – 17948RING-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri199 – 26466IBR-typeAdd
    BLAST
    Zinc fingeri301 – 33232RING-type 2PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ligase activity Source: UniProtKB-KW
    2. transcription factor binding Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. microtubule cytoskeleton organization Source: UniProtKB
    2. protein ubiquitination Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    E3 ubiquitin-protein ligase RNF19A (EC:6.3.2.-)
    Alternative name(s):
    Double ring-finger protein
    Short name:
    Dorfin
    RING finger protein 19A
    p38
    Gene namesi
    Name:RNF19A
    Synonyms:RNF19
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:13432. RNF19A.

    Subcellular locationi

    Membrane Curated; Multi-pass membrane protein Curated. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 4 Publications
    Note: Present in the hyaline inclusion bodies specifically found in motor neurons from amyotrophic lateral sclerosis patients. Present in the Lewy bodies specifically found in neurons from Parkinson disease patients.

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. cytoplasm Source: UniProtKB-KW
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi132 – 1321C → S: Abolishes interaction with VCP and E3 ligase activity toward mutant SOD1; when associated with S-135. 1 Publication
    Mutagenesisi135 – 1351C → S: Abolishes interaction with VCP and E3 ligase activity toward mutant SOD1; when associated with S-132. 1 Publication

    Organism-specific databases

    PharmGKBiPA162401601.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 838838E3 ubiquitin-protein ligase RNF19APRO_0000056061Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei631 – 6311Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ9NV58.
    PRIDEiQ9NV58.

    PTM databases

    PhosphoSiteiQ9NV58.

    Expressioni

    Tissue specificityi

    Widely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system.1 Publication

    Gene expression databases

    ArrayExpressiQ9NV58.
    BgeeiQ9NV58.
    CleanExiHS_RNF19A.
    GenevestigatoriQ9NV58.

    Organism-specific databases

    HPAiCAB011455.
    HPA023652.

    Interactioni

    Subunit structurei

    Interacts with UBE2L3 and UBE2L6. Interacts with transcription factor Sp1. Interacts with VCP, CASR, SNCAIP and with some SOD1 variants which cause amyotrophic lateral sclerosis, but not with wild-type SOD1.6 Publications

    Protein-protein interaction databases

    BioGridi117405. 15 interactions.
    IntActiQ9NV58. 7 interactions.
    STRINGi9606.ENSP00000342667.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NV58.
    SMRiQ9NV58. Positions 130-362.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei368 – 38821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei424 – 44421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni660 – 838179Interaction with CASRAdd
    BLAST

    Sequence similaritiesi

    Belongs to the RBR family. RNF19 subfamily.Curated
    Contains 1 IBR-type zinc finger.Curated
    Contains 2 RING-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri132 – 17948RING-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri199 – 26466IBR-typeAdd
    BLAST
    Zinc fingeri301 – 33232RING-type 2PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG245345.
    HOVERGENiHBG052073.
    InParanoidiQ9NV58.
    KOiK11972.
    OMAiSNMKINE.
    OrthoDBiEOG7JDQXT.
    PhylomeDBiQ9NV58.
    TreeFamiTF324777.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR002867. Znf_C6HC.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF01485. IBR. 2 hits.
    [Graphical view]
    SMARTiSM00647. IBR. 2 hits.
    SM00184. RING. 1 hit.
    [Graphical view]
    PROSITEiPS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NV58-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQEQEIGFIS KYNEGLCVNT DPVSILTSIL DMSLHRQMGS DRDLQSSASS    50
    VSLPSVKKAP KKRRISIGSL FRRKKDNKRK SRELNGGVDG IASIESIHSE 100
    MCTDKNSIFS TNTSSDNGLT SISKQIGDFI ECPLCLLRHS KDRFPDIMTC 150
    HHRSCVDCLR QYLRIEISES RVNISCPECT ERFNPHDIRL ILSDDVLMEK 200
    YEEFMLRRWL VADPDCRWCP APDCGYAVIA FGCASCPKLT CGREGCGTEF 250
    CYHCKQIWHP NQTCDAARQE RAQSLRLRTI RSSSISYSQE SGAAADDIKP 300
    CPRCAAYIIK MNDGSCNHMT CAVCGCEFCW LCMKEISDLH YLSPSGCTFW 350
    GKKPWSRKKK ILWQLGTLVG APVGIALIAG IAIPAMIIGI PVYVGRKIHN 400
    RYEGKDVSKH KRNLAIAGGV TLSVIVSPVV AAVTVGIGVP IMLAYVYGVV 450
    PISLCRSGGC GVSAGNGKGV RIEFDDENDI NVGGTNTAVD TTSVAEARHN 500
    PSIGEGSVGG LTGSLSASGS HMDRIGAIRD NLSETASTMA LAGASITGSL 550
    SGSAMVNCFN RLEVQADVQK ERYSLSGESG TVSLGTVSDN ASTKAMAGSI 600
    LNSYIPLDKE GNSMEVQVDI ESKPSKFRHN SGSSSVDDGS ATRSHAGGSS 650
    SGLPEGKSSA TKWSKEATAG KKSKSGKLRK KGNMKINETR EDMDAQLLEQ 700
    QSTNSSEFEA PSLSDSMPSV ADSHSSHFSE FSCSDLESMK TSCSHGSSDY 750
    HTRFATVNIL PEVENDRLEN SPHQCSISVV TQTASCSEVS QLNHIAEEHG 800
    NNGIKPNVDL YFGDALKETN NNHSHQTMEL KVAIQTEI 838
    Length:838
    Mass (Da):90,696
    Last modified:October 17, 2006 - v3
    Checksum:i00A7DED5023FDC06
    GO
    Isoform 2 (identifier: Q9NV58-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         572-604: RYSLSGESGTVSLGTVSDNASTKAMAGSILNSY → AAVAAAGRWAYSPATLRCRRSEELKNIHDSS
         605-838: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:602
    Mass (Da):65,416
    Checksum:i0B210220B7C0F623
    GO
    Isoform 3 (identifier: Q9NV58-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: Missing.

    Show »
    Length:807
    Mass (Da):87,256
    Checksum:iF50D47C3EA851842
    GO

    Sequence cautioni

    The sequence BAB14581.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB15647.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti645 – 6451H → Y in BAB39353. (PubMed:11237715)Curated
    Sequence conflicti744 – 7441S → R in CAB53700. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti835 – 8351Q → H.
    Corresponds to variant rs9642785 [ dbSNP | Ensembl ].
    VAR_028045

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3131Missing in isoform 3. 1 PublicationVSP_028631Add
    BLAST
    Alternative sequencei572 – 60433RYSLS…ILNSY → AAVAAAGRWAYSPATLRCRR SEELKNIHDSS in isoform 2. 1 PublicationVSP_021010Add
    BLAST
    Alternative sequencei605 – 838234Missing in isoform 2. 1 PublicationVSP_021011Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB029316 mRNA. Translation: BAB39353.1.
    BC093938 mRNA. Translation: AAH93938.1.
    BC093940 mRNA. Translation: AAH93940.1.
    AB271914 mRNA. Translation: BAF48117.1.
    AK001774 mRNA. Translation: BAA91900.1.
    AK023455 mRNA. Translation: BAB14581.1. Different initiation.
    AK027070 mRNA. Translation: BAB15647.1. Different initiation.
    AJ242975 mRNA. Translation: CAB45132.1.
    AL110253 mRNA. Translation: CAB53700.1.
    AL122096 mRNA. Translation: CAB59264.1.
    CCDSiCCDS6286.1. [Q9NV58-1]
    PIRiT34528.
    RefSeqiNP_001267468.1. NM_001280539.1. [Q9NV58-1]
    NP_056250.3. NM_015435.4. [Q9NV58-1]
    NP_904355.1. NM_183419.3. [Q9NV58-1]
    XP_005250910.1. XM_005250853.1. [Q9NV58-1]
    UniGeneiHs.292882.

    Genome annotation databases

    EnsembliENST00000341084; ENSP00000342667; ENSG00000034677. [Q9NV58-1]
    ENST00000517584; ENSP00000429161; ENSG00000034677.
    ENST00000519449; ENSP00000428968; ENSG00000034677. [Q9NV58-1]
    GeneIDi25897.
    KEGGihsa:25897.
    UCSCiuc003yjj.1. human. [Q9NV58-1]

    Polymorphism databases

    DMDMi116242764.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB029316 mRNA. Translation: BAB39353.1 .
    BC093938 mRNA. Translation: AAH93938.1 .
    BC093940 mRNA. Translation: AAH93940.1 .
    AB271914 mRNA. Translation: BAF48117.1 .
    AK001774 mRNA. Translation: BAA91900.1 .
    AK023455 mRNA. Translation: BAB14581.1 . Different initiation.
    AK027070 mRNA. Translation: BAB15647.1 . Different initiation.
    AJ242975 mRNA. Translation: CAB45132.1 .
    AL110253 mRNA. Translation: CAB53700.1 .
    AL122096 mRNA. Translation: CAB59264.1 .
    CCDSi CCDS6286.1. [Q9NV58-1 ]
    PIRi T34528.
    RefSeqi NP_001267468.1. NM_001280539.1. [Q9NV58-1 ]
    NP_056250.3. NM_015435.4. [Q9NV58-1 ]
    NP_904355.1. NM_183419.3. [Q9NV58-1 ]
    XP_005250910.1. XM_005250853.1. [Q9NV58-1 ]
    UniGenei Hs.292882.

    3D structure databases

    ProteinModelPortali Q9NV58.
    SMRi Q9NV58. Positions 130-362.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117405. 15 interactions.
    IntActi Q9NV58. 7 interactions.
    STRINGi 9606.ENSP00000342667.

    PTM databases

    PhosphoSitei Q9NV58.

    Polymorphism databases

    DMDMi 116242764.

    Proteomic databases

    PaxDbi Q9NV58.
    PRIDEi Q9NV58.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000341084 ; ENSP00000342667 ; ENSG00000034677 . [Q9NV58-1 ]
    ENST00000517584 ; ENSP00000429161 ; ENSG00000034677 .
    ENST00000519449 ; ENSP00000428968 ; ENSG00000034677 . [Q9NV58-1 ]
    GeneIDi 25897.
    KEGGi hsa:25897.
    UCSCi uc003yjj.1. human. [Q9NV58-1 ]

    Organism-specific databases

    CTDi 25897.
    GeneCardsi GC08M101269.
    HGNCi HGNC:13432. RNF19A.
    HPAi CAB011455.
    HPA023652.
    MIMi 607119. gene.
    neXtProti NX_Q9NV58.
    PharmGKBi PA162401601.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG245345.
    HOVERGENi HBG052073.
    InParanoidi Q9NV58.
    KOi K11972.
    OMAi SNMKINE.
    OrthoDBi EOG7JDQXT.
    PhylomeDBi Q9NV58.
    TreeFami TF324777.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .

    Miscellaneous databases

    ChiTaRSi RNF19A. human.
    GeneWikii RNF19A.
    GenomeRNAii 25897.
    NextBioi 47345.
    PROi Q9NV58.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NV58.
    Bgeei Q9NV58.
    CleanExi HS_RNF19A.
    Genevestigatori Q9NV58.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR002867. Znf_C6HC.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF01485. IBR. 2 hits.
    [Graphical view ]
    SMARTi SM00647. IBR. 2 hits.
    SM00184. RING. 1 hit.
    [Graphical view ]
    PROSITEi PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity."
      Niwa J., Ishigaki S., Doyu M., Suzuki T., Tanaka K., Sobue G.
      Biochem. Biophys. Res. Commun. 281:706-713(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH UBE2L3 AND UBE2L6, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Spinal cord.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Expression and promoter activity of MaLR element of Dorfin gene related to Parkinson disease."
      Kim T., Huh J., Kim H.
      Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-89 (ISOFORM 3).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 426-838 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-838 (ISOFORM 2).
      Tissue: Hepatoma, Ovarian carcinoma and Placenta.
    5. "A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening."
      Gunther M., Laithier M., Brison O.
      Mol. Cell. Biochem. 210:131-142(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 422-824 (ISOFORM 1), INTERACTION WITH SP1.
      Tissue: Colon.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 524-838 (ISOFORM 1).
      Tissue: Fetal kidney and Testis.
    7. "Dorfin ubiquitylates mutant SOD1 and prevents mutant SOD1-mediated neurotoxicity."
      Niwa J., Ishigaki S., Hishikawa N., Yamamoto M., Doyu M., Murata S., Tanaka K., Taniguchi N., Sobue G.
      J. Biol. Chem. 277:36793-36798(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SOD1.
    8. "Dorfin localizes to Lewy bodies and ubiquitylates synphilin-1."
      Ito T., Niwa J., Hishikawa N., Ishigaki S., Doyu M., Sobue G.
      J. Biol. Chem. 278:29106-29114(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SNCAIP.
    9. "Physical and functional interaction between dorfin and valosin-containing protein that are colocalized in ubiquitylated inclusions in neurodegenerative disorders."
      Ishigaki S., Hishikawa N., Niwa J., Iemura S., Natsume T., Hori S., Kakizuka A., Tanaka K., Sobue G.
      J. Biol. Chem. 279:51376-51385(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH VCP, MUTAGENESIS OF CYS-132 AND CYS-135, SUBCELLULAR LOCATION.
    10. "Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin."
      Huang Y., Niwa J., Sobue G., Breitwieser G.E.
      J. Biol. Chem. 281:11610-11617(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CASR AND VCP.
    11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-631, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRN19A_HUMAN
    AccessioniPrimary (citable) accession number: Q9NV58
    Secondary accession number(s): A3KCU9
    , Q52LG1, Q9H5H9, Q9H8M8, Q9UFG0, Q9UFX6, Q9Y4Y1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2001
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 132 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3