Q9NV23 (SAST_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: S-acyl fatty acid synthase thioesterase, medium chain EC=3.1.2.14 Alternative name(s): Augmented in rheumatoid arthritis 1 Short name=AURA1 Oleoyl-ACP hydrolase Thioesterase II Thioesterase domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 265 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2) By similarity. |
| Catalytic activity | Oleoyl-[acyl-carrier-protein] + H2O = [acyl-carrier-protein] + oleate. |
| Tissue specificity | Isoform 2: Up-regulated in bone marrow-derived mononuclear cells of rheumatoid arthritis patients. Ref.5 |
| Sequence similarities | Belongs to the thioesterase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Fatty acid biosynthesis Lipid synthesis |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | fatty acid biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | myristoyl-[acyl-carrier-protein] hydrolase activity Inferred from electronic annotation. Source: EC oleoyl-[acyl-carrier-protein] hydrolase activityInferred from electronic annotation. Source: EC palmitoyl-[acyl-carrier-protein] hydrolase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NV23-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NV23-2) The sequence of this isoform differs from the canonical sequence as follows: 55-55: V → ETASHHVAKAGLKLRRSSDPPASAYPCAGVSHRRREPPCLAKILGLFWILIFFM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 265 | 265 | S-acyl fatty acid synthase thioesterase, medium chain | PRO_0000180358 | |||||
Sites | |||||||||
| Active site | 101 | 1 | By similarity | ||||||
| Active site | 237 | 1 | By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 55 | 1 | V → ETASHHVAKAGLKLRRSSDP PASAYPCAGVSHRRREPPCL AKILGLFWILIFFM in isoform 2. | VSP_040022 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK001844 mRNA. Translation: BAA91937.1. AK001968 mRNA. Translation: BAA92007.1. AL590365 Genomic DNA. Translation: CAH73961.1. AL590365 Genomic DNA. Translation: CAH73962.1. CH471072 Genomic DNA. Translation: EAW86244.1. CH471072 Genomic DNA. Translation: EAW86245.1. BC050372 mRNA. Translation: AAH50372.1. BR000403 mRNA. Translation: FAA00320.1. |
| IPI | IPI00019562. IPI00030167. |
| RefSeq | NP_001034791.1. NM_001039702.2. NP_060794.1. NM_018324.2. |
| UniGene | Hs.24309. |
3D structure databases | |
| ProteinModelPortal | Q9NV23. |
| SMR | Q9NV23. Positions 10-257. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9NV23. |
Polymorphism databases | |
| DMDM | 52783423. |
Proteomic databases | |
| PRIDE | Q9NV23. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378228; ENSP00000367473; ENSG00000152463. |
| GeneID | 55301. |
| KEGG | hsa:55301. |
| UCSC | uc001inu.1. human. |
Organism-specific databases | |
| CTD | 55301. |
| GeneCards | GC10P015074. |
| HGNC | HGNC:25625. OLAH. |
| HPA | HPA037947. HPA037948. |
| neXtProt | NX_Q9NV23. |
| PharmGKB | PA134955731. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000015518. |
| HOVERGEN | HBG015455. |
| OMA | SCDLTCF. |
| PhylomeDB | Q9NV23. |
Gene expression databases | |
| ArrayExpress | Q9NV23. |
| Bgee | Q9NV23. |
| CleanEx | HS_OLAH. |
| Genevestigator | Q9NV23. |
| GermOnline | ENSG00000152463. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012223. TEII. IPR001031. Thioesterase. [Graphical view] |
| KO | K01071. |
| PANTHER | PTHR11487. TEII. 1 hit. |
| Pfam | PF00975. Thioesterase. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 59524. |
Entry information
| Entry name | SAST_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NV23 Secondary accession number(s): Q5VUB6, Q9NUW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with