Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SPATS2-like protein

Gene

SPATS2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
SPATS2-like protein
Alternative name(s):
DNA polymerase-transactivated protein 6
Stress granule and nucleolar protein
Short name:
SGNP
Gene namesi
Name:SPATS2L
Synonyms:DNAPTP6
ORF Names:SP1224
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000196141.12
HGNCiHGNC:24574 SPATS2L
MIMi613817 gene
neXtProtiNX_Q9NUQ6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi26010
OpenTargetsiENSG00000196141
PharmGKBiPA165697465

Polymorphism and mutation databases

BioMutaiSPATS2L
DMDMi160185484

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003076992 – 558SPATS2-like proteinAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei120PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9NUQ6
MaxQBiQ9NUQ6
PaxDbiQ9NUQ6
PeptideAtlasiQ9NUQ6
PRIDEiQ9NUQ6

PTM databases

iPTMnetiQ9NUQ6
PhosphoSitePlusiQ9NUQ6

Expressioni

Gene expression databases

BgeeiENSG00000196141
ExpressionAtlasiQ9NUQ6 baseline and differential
GenevisibleiQ9NUQ6 HS

Organism-specific databases

HPAiHPA055427
HPA066310

Interactioni

Protein-protein interaction databases

BioGridi117483, 21 interactors
IntActiQ9NUQ6, 19 interactors
MINTiQ9NUQ6
STRINGi9606.ENSP00000351503

Structurei

3D structure databases

ProteinModelPortaliQ9NUQ6
SMRiQ9NUQ6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili271 – 344Sequence analysisAdd BLAST74

Sequence similaritiesi

Belongs to the SPATS2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJV6 Eukaryota
ENOG410Y9WN LUCA
GeneTreeiENSGT00390000001138
HOGENOMiHOG000013053
HOVERGENiHBG059711
InParanoidiQ9NUQ6
OMAiPQIQNGH
OrthoDBiEOG091G05XT
PhylomeDBiQ9NUQ6
TreeFamiTF320553

Family and domain databases

InterProiView protein in InterPro
IPR009816 DUF1387
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF07139 DUF1387, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NUQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELNTHVNV KEKIYAVRSV VPNKSNNEIV LVLQQFDFNV DKAVQAFVDG
60 70 80 90 100
SAIQVLKEWN MTGKKKNNKR KRSKSKQHQG NKDAKDKVER PEAGPLQPQP
110 120 130 140 150
PQIQNGPMNG CEKDSSSTDS ANEKPALIPR EKKISILEEP SKALRGVTEG
160 170 180 190 200
NRLLQQKLSL DGNPKPIHGT TERSDGLQWS AEQPCNPSKP KAKTSPVKSN
210 220 230 240 250
TPAAHLEIKP DELAKKRGPN IEKSVKDLQR CTVSLTRYRV MIKEEVDSSV
260 270 280 290 300
KKIKAAFAEL HNCIIDKEVS LMAEMDKVKE EAMEILTARQ KKAEELKRLT
310 320 330 340 350
DLASQMAEMQ LAELRAEIKH FVSERKYDEE LGKAARFSCD IEQLKAQIML
360 370 380 390 400
CGEITHPKNN YSSRTPCSSL LPLLNAHAAT SGKQSNFSRK SSTHNKPSEG
410 420 430 440 450
KAANPKMVSS LPSTADPSHQ TMPANKQNGS SNQRRRFNPQ YHNNRLNGPA
460 470 480 490 500
KSQGSGNEAE PLGKGNSRHE HRRQPHNGFR PKNKGGAKNQ EASLGMKTPE
510 520 530 540 550
APAHSEKPRR RQHAADTSEA RPFRGSVGRV SQCNLCPTRI EVSTDAAVLS

VPAVTLVA
Length:558
Mass (Da):61,729
Last modified:October 23, 2007 - v2
Checksum:iC2BB3431BA1E7B4C
GO
Isoform 2 (identifier: Q9NUQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-217: Missing.

Show »
Length:489
Mass (Da):54,178
Checksum:iE52B645A57817507
GO
Isoform 3 (identifier: Q9NUQ6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPFCHSSSETRLLSGTLLWIPRAYSTRSKM

Note: No experimental confirmation available.
Show »
Length:588
Mass (Da):65,152
Checksum:iF3FC15DE9749189B
GO
Isoform 4 (identifier: Q9NUQ6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYSTRSKM

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):62,654
Checksum:i2C0CCF0CFA9AEB09
GO

Sequence cautioni

The sequence AAG22487 differs from that shown. Reason: Frameshift at position 92.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64Missing in AAH18736 (PubMed:15489334).Curated1
Sequence conflicti255A → T in BAA92065 (PubMed:14702039).Curated1
Sequence conflicti301D → N in AAR21087 (Ref. 1) Curated1
Sequence conflicti301D → N in CAB53658 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542411M → MDPFCHSSSETRLLSGTLLW IPRAYSTRSKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0542421M → MAYSTRSKM in isoform 4. 1 Publication1
Alternative sequenceiVSP_028792149 – 217Missing in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY450394 mRNA Translation: AAR21087.1
AL110124 mRNA Translation: CAB53658.2
AK002064 mRNA Translation: BAA92065.1
AK290496 mRNA Translation: BAF83185.1
AK299223 mRNA Translation: BAG61258.1
AK300075 mRNA Translation: BAG61879.1
AF193059 mRNA Translation: AAG22487.1 Frameshift.
AC074213 Genomic DNA No translation available.
AC012459 Genomic DNA Translation: AAY24307.1
AC105381 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70197.1
BC018736 mRNA Translation: AAH18736.1
CCDSiCCDS46483.1 [Q9NUQ6-1]
CCDS46484.1 [Q9NUQ6-2]
CCDS74621.1 [Q9NUQ6-3]
PIRiT14738
RefSeqiNP_001093892.1, NM_001100422.1 [Q9NUQ6-1]
NP_001093893.1, NM_001100423.1 [Q9NUQ6-1]
NP_001093894.1, NM_001100424.1 [Q9NUQ6-2]
NP_001269664.1, NM_001282735.1 [Q9NUQ6-1]
NP_001269672.1, NM_001282743.1
NP_001269673.1, NM_001282744.1 [Q9NUQ6-3]
NP_056350.2, NM_015535.2 [Q9NUQ6-1]
XP_005246513.1, XM_005246456.1 [Q9NUQ6-1]
XP_005246514.1, XM_005246457.1 [Q9NUQ6-1]
XP_005246515.1, XM_005246458.1 [Q9NUQ6-1]
XP_005246516.1, XM_005246459.1 [Q9NUQ6-2]
XP_011509240.1, XM_011510938.1 [Q9NUQ6-3]
XP_011509241.1, XM_011510939.1 [Q9NUQ6-1]
XP_016859272.1, XM_017003783.1 [Q9NUQ6-3]
XP_016859274.1, XM_017003785.1 [Q9NUQ6-2]
XP_016859275.1, XM_017003786.1 [Q9NUQ6-2]
XP_016859276.1, XM_017003787.1 [Q9NUQ6-2]
UniGeneiHs.120323

Genome annotation databases

EnsembliENST00000358677; ENSP00000351503; ENSG00000196141 [Q9NUQ6-1]
ENST00000360760; ENSP00000353989; ENSG00000196141 [Q9NUQ6-2]
ENST00000409140; ENSP00000386730; ENSG00000196141 [Q9NUQ6-1]
ENST00000409151; ENSP00000386310; ENSG00000196141 [Q9NUQ6-4]
ENST00000409718; ENSP00000386336; ENSG00000196141 [Q9NUQ6-1]
ENST00000409988; ENSP00000386931; ENSG00000196141 [Q9NUQ6-1]
ENST00000451764; ENSP00000391467; ENSG00000196141 [Q9NUQ6-1]
ENST00000619961; ENSP00000482515; ENSG00000196141 [Q9NUQ6-3]
GeneIDi26010
KEGGihsa:26010
UCSCiuc002uvn.5 human [Q9NUQ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPS2L_HUMAN
AccessioniPrimary (citable) accession number: Q9NUQ6
Secondary accession number(s): A8K381
, B4DRE6, B4DT67, B7WNZ7, Q53T22, Q8WV53, Q8WYG1, Q9NTW4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: May 23, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health