Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SPATS2-like protein

Gene

SPATS2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
SPATS2-like protein
Alternative name(s):
DNA polymerase-transactivated protein 6
Stress granule and nucleolar protein
Short name:
SGNP
Gene namesi
Name:SPATS2L
Synonyms:DNAPTP6
ORF Names:SP1224
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24574. SPATS2L.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleusnucleolus 1 Publication

  • Note: During oxidative stress as well as UV irradiation, energy deprivation or heat shock, relocalizes to cytoplasmic stress granules. In the nucleus, found in structures lacking NPM1.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165697465.

Polymorphism and mutation databases

BioMutaiSPATS2L.
DMDMi160185484.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedCombined sources
Chaini2 – 558557SPATS2-like proteinPRO_0000307699Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineCombined sources
Modified residuei120 – 1201PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9NUQ6.
MaxQBiQ9NUQ6.
PaxDbiQ9NUQ6.
PRIDEiQ9NUQ6.

PTM databases

iPTMnetiQ9NUQ6.
PhosphoSiteiQ9NUQ6.

Expressioni

Gene expression databases

BgeeiQ9NUQ6.
ExpressionAtlasiQ9NUQ6. baseline and differential.
GenevisibleiQ9NUQ6. HS.

Organism-specific databases

HPAiHPA053965.
HPA055427.

Interactioni

Protein-protein interaction databases

BioGridi117483. 16 interactions.
IntActiQ9NUQ6. 14 interactions.
MINTiMINT-4992163.
STRINGi9606.ENSP00000351503.

Structurei

3D structure databases

ProteinModelPortaliQ9NUQ6.
SMRiQ9NUQ6. Positions 6-73.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili271 – 34474Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the SPATS2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJV6. Eukaryota.
ENOG410Y9WN. LUCA.
GeneTreeiENSGT00390000001138.
HOGENOMiHOG000013053.
HOVERGENiHBG059711.
InParanoidiQ9NUQ6.
OMAiPQIQNGH.
OrthoDBiEOG76T9R1.
PhylomeDBiQ9NUQ6.
TreeFamiTF320553.

Family and domain databases

InterProiIPR009816. DUF1387.
IPR009060. UBA-like.
[Graphical view]
PfamiPF07139. DUF1387. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NUQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELNTHVNV KEKIYAVRSV VPNKSNNEIV LVLQQFDFNV DKAVQAFVDG
60 70 80 90 100
SAIQVLKEWN MTGKKKNNKR KRSKSKQHQG NKDAKDKVER PEAGPLQPQP
110 120 130 140 150
PQIQNGPMNG CEKDSSSTDS ANEKPALIPR EKKISILEEP SKALRGVTEG
160 170 180 190 200
NRLLQQKLSL DGNPKPIHGT TERSDGLQWS AEQPCNPSKP KAKTSPVKSN
210 220 230 240 250
TPAAHLEIKP DELAKKRGPN IEKSVKDLQR CTVSLTRYRV MIKEEVDSSV
260 270 280 290 300
KKIKAAFAEL HNCIIDKEVS LMAEMDKVKE EAMEILTARQ KKAEELKRLT
310 320 330 340 350
DLASQMAEMQ LAELRAEIKH FVSERKYDEE LGKAARFSCD IEQLKAQIML
360 370 380 390 400
CGEITHPKNN YSSRTPCSSL LPLLNAHAAT SGKQSNFSRK SSTHNKPSEG
410 420 430 440 450
KAANPKMVSS LPSTADPSHQ TMPANKQNGS SNQRRRFNPQ YHNNRLNGPA
460 470 480 490 500
KSQGSGNEAE PLGKGNSRHE HRRQPHNGFR PKNKGGAKNQ EASLGMKTPE
510 520 530 540 550
APAHSEKPRR RQHAADTSEA RPFRGSVGRV SQCNLCPTRI EVSTDAAVLS

VPAVTLVA
Length:558
Mass (Da):61,729
Last modified:October 23, 2007 - v2
Checksum:iC2BB3431BA1E7B4C
GO
Isoform 2 (identifier: Q9NUQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-217: Missing.

Show »
Length:489
Mass (Da):54,178
Checksum:iE52B645A57817507
GO
Isoform 3 (identifier: Q9NUQ6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPFCHSSSETRLLSGTLLWIPRAYSTRSKM

Note: No experimental confirmation available.
Show »
Length:588
Mass (Da):65,152
Checksum:iF3FC15DE9749189B
GO
Isoform 4 (identifier: Q9NUQ6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYSTRSKM

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):62,654
Checksum:i2C0CCF0CFA9AEB09
GO

Sequence cautioni

The sequence AAG22487.1 differs from that shown. Reason: Frameshift at position 92. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641Missing in AAH18736 (PubMed:15489334).Curated
Sequence conflicti255 – 2551A → T in BAA92065 (PubMed:14702039).Curated
Sequence conflicti301 – 3011D → N in AAR21087 (Ref. 1) Curated
Sequence conflicti301 – 3011D → N in CAB53658 (PubMed:11230166).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MDPFCHSSSETRLLSGTLLW IPRAYSTRSKM in isoform 3. 1 PublicationVSP_054241
Alternative sequencei1 – 11M → MAYSTRSKM in isoform 4. 1 PublicationVSP_054242
Alternative sequencei149 – 21769Missing in isoform 2. 1 PublicationVSP_028792Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY450394 mRNA. Translation: AAR21087.1.
AL110124 mRNA. Translation: CAB53658.2.
AK002064 mRNA. Translation: BAA92065.1.
AK290496 mRNA. Translation: BAF83185.1.
AK299223 mRNA. Translation: BAG61258.1.
AK300075 mRNA. Translation: BAG61879.1.
AF193059 mRNA. Translation: AAG22487.1. Frameshift.
AC074213 Genomic DNA. No translation available.
AC012459 Genomic DNA. Translation: AAY24307.1.
AC105381 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70197.1.
BC018736 mRNA. Translation: AAH18736.1.
CCDSiCCDS46483.1. [Q9NUQ6-1]
CCDS46484.1. [Q9NUQ6-2]
CCDS74621.1. [Q9NUQ6-3]
PIRiT14738.
RefSeqiNP_001093892.1. NM_001100422.1. [Q9NUQ6-1]
NP_001093893.1. NM_001100423.1. [Q9NUQ6-1]
NP_001093894.1. NM_001100424.1. [Q9NUQ6-2]
NP_001269664.1. NM_001282735.1. [Q9NUQ6-1]
NP_001269672.1. NM_001282743.1.
NP_001269673.1. NM_001282744.1. [Q9NUQ6-3]
NP_056350.2. NM_015535.2. [Q9NUQ6-1]
XP_005246513.1. XM_005246456.1. [Q9NUQ6-1]
XP_005246514.1. XM_005246457.1. [Q9NUQ6-1]
XP_005246515.1. XM_005246458.1. [Q9NUQ6-1]
XP_005246516.1. XM_005246459.1. [Q9NUQ6-2]
XP_011509240.1. XM_011510938.1. [Q9NUQ6-3]
XP_011509241.1. XM_011510939.1. [Q9NUQ6-1]
XP_011509242.1. XM_011510940.1. [Q9NUQ6-2]
UniGeneiHs.120323.

Genome annotation databases

EnsembliENST00000358677; ENSP00000351503; ENSG00000196141. [Q9NUQ6-1]
ENST00000360760; ENSP00000353989; ENSG00000196141. [Q9NUQ6-2]
ENST00000409140; ENSP00000386730; ENSG00000196141. [Q9NUQ6-1]
ENST00000409151; ENSP00000386310; ENSG00000196141. [Q9NUQ6-4]
ENST00000409718; ENSP00000386336; ENSG00000196141. [Q9NUQ6-1]
ENST00000409988; ENSP00000386931; ENSG00000196141. [Q9NUQ6-1]
ENST00000451764; ENSP00000391467; ENSG00000196141. [Q9NUQ6-1]
ENST00000619961; ENSP00000482515; ENSG00000196141. [Q9NUQ6-3]
GeneIDi26010.
KEGGihsa:26010.
UCSCiuc002uvn.5. human. [Q9NUQ6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY450394 mRNA. Translation: AAR21087.1.
AL110124 mRNA. Translation: CAB53658.2.
AK002064 mRNA. Translation: BAA92065.1.
AK290496 mRNA. Translation: BAF83185.1.
AK299223 mRNA. Translation: BAG61258.1.
AK300075 mRNA. Translation: BAG61879.1.
AF193059 mRNA. Translation: AAG22487.1. Frameshift.
AC074213 Genomic DNA. No translation available.
AC012459 Genomic DNA. Translation: AAY24307.1.
AC105381 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW70197.1.
BC018736 mRNA. Translation: AAH18736.1.
CCDSiCCDS46483.1. [Q9NUQ6-1]
CCDS46484.1. [Q9NUQ6-2]
CCDS74621.1. [Q9NUQ6-3]
PIRiT14738.
RefSeqiNP_001093892.1. NM_001100422.1. [Q9NUQ6-1]
NP_001093893.1. NM_001100423.1. [Q9NUQ6-1]
NP_001093894.1. NM_001100424.1. [Q9NUQ6-2]
NP_001269664.1. NM_001282735.1. [Q9NUQ6-1]
NP_001269672.1. NM_001282743.1.
NP_001269673.1. NM_001282744.1. [Q9NUQ6-3]
NP_056350.2. NM_015535.2. [Q9NUQ6-1]
XP_005246513.1. XM_005246456.1. [Q9NUQ6-1]
XP_005246514.1. XM_005246457.1. [Q9NUQ6-1]
XP_005246515.1. XM_005246458.1. [Q9NUQ6-1]
XP_005246516.1. XM_005246459.1. [Q9NUQ6-2]
XP_011509240.1. XM_011510938.1. [Q9NUQ6-3]
XP_011509241.1. XM_011510939.1. [Q9NUQ6-1]
XP_011509242.1. XM_011510940.1. [Q9NUQ6-2]
UniGeneiHs.120323.

3D structure databases

ProteinModelPortaliQ9NUQ6.
SMRiQ9NUQ6. Positions 6-73.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117483. 16 interactions.
IntActiQ9NUQ6. 14 interactions.
MINTiMINT-4992163.
STRINGi9606.ENSP00000351503.

PTM databases

iPTMnetiQ9NUQ6.
PhosphoSiteiQ9NUQ6.

Polymorphism and mutation databases

BioMutaiSPATS2L.
DMDMi160185484.

Proteomic databases

EPDiQ9NUQ6.
MaxQBiQ9NUQ6.
PaxDbiQ9NUQ6.
PRIDEiQ9NUQ6.

Protocols and materials databases

DNASUi26010.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358677; ENSP00000351503; ENSG00000196141. [Q9NUQ6-1]
ENST00000360760; ENSP00000353989; ENSG00000196141. [Q9NUQ6-2]
ENST00000409140; ENSP00000386730; ENSG00000196141. [Q9NUQ6-1]
ENST00000409151; ENSP00000386310; ENSG00000196141. [Q9NUQ6-4]
ENST00000409718; ENSP00000386336; ENSG00000196141. [Q9NUQ6-1]
ENST00000409988; ENSP00000386931; ENSG00000196141. [Q9NUQ6-1]
ENST00000451764; ENSP00000391467; ENSG00000196141. [Q9NUQ6-1]
ENST00000619961; ENSP00000482515; ENSG00000196141. [Q9NUQ6-3]
GeneIDi26010.
KEGGihsa:26010.
UCSCiuc002uvn.5. human. [Q9NUQ6-1]

Organism-specific databases

CTDi26010.
GeneCardsiSPATS2L.
H-InvDBHIX0002721.
HGNCiHGNC:24574. SPATS2L.
HPAiHPA053965.
HPA055427.
MIMi613817. gene.
neXtProtiNX_Q9NUQ6.
PharmGKBiPA165697465.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJV6. Eukaryota.
ENOG410Y9WN. LUCA.
GeneTreeiENSGT00390000001138.
HOGENOMiHOG000013053.
HOVERGENiHBG059711.
InParanoidiQ9NUQ6.
OMAiPQIQNGH.
OrthoDBiEOG76T9R1.
PhylomeDBiQ9NUQ6.
TreeFamiTF320553.

Miscellaneous databases

ChiTaRSiSPATS2L. human.
GeneWikiiSPATS2L.
GenomeRNAii26010.
NextBioi35474367.
PROiQ9NUQ6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NUQ6.
ExpressionAtlasiQ9NUQ6. baseline and differential.
GenevisibleiQ9NUQ6. HS.

Family and domain databases

InterProiIPR009816. DUF1387.
IPR009060. UBA-like.
[Graphical view]
PfamiPF07139. DUF1387. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Screening and cloning of the target genes transactivated by hepatitis B virus DNA polymerase using suppression subtractive hybridization (SSH) technique."
    Wang C., Cheng J., Lang Z., Ji D., Yang Y., Zhang L., Wu Y.
    Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Brain, Pericardium and Placenta.
  4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye.
  8. "SGNP: an essential stress granule/nucleolar protein potentially involved in 5.8s rRNA processing/transport."
    Zhu C.H., Kim J., Shay J.W., Wright W.E.
    PLoS ONE 3:E3716-E3716(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-120, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS], IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-120, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiSPS2L_HUMAN
AccessioniPrimary (citable) accession number: Q9NUQ6
Secondary accession number(s): A8K381
, B4DRE6, B4DT67, B7WNZ7, Q53T22, Q8WV53, Q8WYG1, Q9NTW4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: April 13, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.