Q9NUN5 (LMBD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable lysosomal cobalamin transporter Alternative name(s): HDAg-L-interacting protein NESI LMBR1 domain-containing protein 1 Nuclear export signal-interacting protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 540 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV). Ref.1 Ref.10 |
| Subunit structure | Isoform 3 interacts with Hepatitis delta virus NES(HDAg-L). Ref.1 |
| Subcellular location | |
| Tissue specificity | |
| Post-translational modification | N-glycosylated. Ref.10 |
| Involvement in disease | Methylmalonic aciduria and homocystinuria type cblF (MMAHCF) [MIM:277380]: A disorder of cobalamin metabolism characterized by decreased levels of the coenzymes adenosylcobalamin (AdoCbl) and methylcobalamin (MeCbl). It is due to accumulation of free cobalamin in lysosomes, thus hindering its conversion to cofactors. Clinical features include developmental delay, stomatitis, glossitis, seizures and methylmalonic aciduria responsive to vitamin B12. |
| Sequence similarities | Belongs to the LIMR family. LMBRD1 subfamily. |
| Sequence caution | The sequence AAK26247.1 differs from that shown. Reason: Frameshift at position 137. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Host-virus interaction Transport |
| Cellular component | Lysosome Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Cobalamin Cobalt |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transport Inferred from electronic annotation. Source: UniProtKB-KW virus-host interactionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW lysosomal membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | cobalamin binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NUN5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NUN5-2) The sequence of this isoform differs from the canonical sequence as follows: 362-392: VFPLDYILITIIIMYFIFTSMAGIRNIGIWF → EFEILAYGSFGLDYIKSEEVEPGPKHSFFSA 393-540: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NUN5-3) Also known as: NESI; The sequence of this isoform differs from the canonical sequence as follows: 1-73: Missing. | ||||||
| Isoform 4 (identifier: Q9NUN5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-204: Missing. 362-392: VFPLDYILITIIIMYFIFTSMAGIRNIGIWF → EFEILAYGSFGLDYIKSEEVEPGPKHSFFSA 393-540: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 540 | 540 | Probable lysosomal cobalamin transporter | PRO_0000260515 | |||||
Regions | |||||||||
| Topological domain | 1 – 10 | 10 | Extracellular Potential | ||||||
| Transmembrane | 11 – 31 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 32 – 50 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 51 – 71 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 72 – 100 | 29 | Extracellular Potential | ||||||
| Transmembrane | 101 – 121 | 21 | Helical; Name=3; Potential | ||||||
| Topological domain | 122 – 144 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 145 – 165 | 21 | Helical; Name=4; Potential | ||||||
| Topological domain | 166 – 188 | 23 | Extracellular Potential | ||||||
| Transmembrane | 189 – 209 | 21 | Helical; Name=5; Potential | ||||||
| Topological domain | 210 – 305 | 96 | Cytoplasmic Potential | ||||||
| Transmembrane | 306 – 326 | 21 | Helical; Name=6; Potential | ||||||
| Topological domain | 327 – 364 | 38 | Extracellular Potential | ||||||
| Transmembrane | 365 – 385 | 21 | Helical; Name=7; Potential | ||||||
| Topological domain | 386 – 408 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 409 – 429 | 21 | Helical; Name=8; Potential | ||||||
| Topological domain | 430 – 486 | 57 | Extracellular Potential | ||||||
| Transmembrane | 487 – 507 | 21 | Helical; Name=9; Potential | ||||||
| Topological domain | 508 – 540 | 33 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 238 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 528 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Modified residue | 531 | 1 | Phosphoserine Ref.9 Ref.11 | ||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 88 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 170 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 347 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 448 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 457 | 1 | N-linked (GlcNAc...) Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 204 | 204 | Missing in isoform 4. | VSP_036539 | |||||
| Alternative sequence | 1 – 73 | 73 | Missing in isoform 3. | VSP_021629 | |||||
| Alternative sequence | 362 – 392 | 31 | VFPLD…IGIWF → EFEILAYGSFGLDYIKSEEV EPGPKHSFFSA in isoform 2 and isoform 4. | VSP_021630 | |||||
| Alternative sequence | 393 – 540 | 148 | Missing in isoform 2 and isoform 4. | VSP_036540 | |||||
| Natural variant | 144 | 1 | T → A. Corresponds to variant rs12214456 [ dbSNP | Ensembl ]. | VAR_029047 | |||||
| Natural variant | 395 | 1 | I → V. Ref.7 Corresponds to variant rs17854411 [ dbSNP | Ensembl ]. | VAR_029048 | |||||
| Natural variant | 469 | 1 | D → E. Corresponds to variant rs9354880 [ dbSNP | Ensembl ]. | VAR_029049 | |||||
Experimental info | |||||||||
| Mutagenesis | 78 | 1 | N → Q: Does not affect glycosylation status; when associated with Q-88. Ref.10 | ||||||
| Mutagenesis | 88 | 1 | N → Q: Does not affect glycosylation status; when associated with Q-78. Ref.10 | ||||||
| Mutagenesis | 448 | 1 | N → Q: Affects glycosylation status; when associated with Q-457. Ref.10 | ||||||
| Mutagenesis | 457 | 1 | N → Q: Affects glycosylation status. Affects glycosylation status; when associated with Q-448. Ref.10 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel nuclear export signal-interacting protein, NESI, critical for the assembly of hepatitis delta virus." Wang Y.-H., Chang S.C., Huang C., Li Y.-P., Lee C.-H., Chang M.-F. J. Virol. 79:8113-8120(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH HDAG-L. |
| [2] | Liu B., Liu Y.Q., Wang X.Y., Zhao B., Sheng H., Zhao X.W., Liu S., Xu Y.Y., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Wei Y.J., Cao H.Q., Zhao Y., Liu L.S., Ding J.F. Hui R.T.Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Heart. |
| [3] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Bone marrow. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Placenta and Substantia nigra. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-395. Tissue: Brain. |
| [8] | "A novel gene expressed in human pheochromocytoma." Li N., Song H., Peng Y., Xiao H., Han Z., Chen Z. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 130-540 (ISOFORMS 1/3). Tissue: Pheochromocytoma. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-528 AND SER-531, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Identification of a putative lysosomal cobalamin exporter altered in the cblF defect of vitamin B12 metabolism." Rutsch F., Gailus S., Miousse I.R., Suormala T., Sagne C., Toliat M.R., Nuernberg G., Wittkampf T., Buers I., Sharifi A., Stucki M., Becker C., Baumgartner M., Robenek H., Marquardt T., Hoehne W., Gasnier B., Rosenblatt D.S., Fowler B., Nuernberg P. Nat. Genet. 41:234-239(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MMAHCF, FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, GLYCOSYLATION, MUTAGENESIS OF ASN-78; ASN-88; ASN-448 AND ASN-457. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-528 AND SER-531, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY136817 mRNA. Translation: AAN11301.1. AF113224 mRNA. Translation: AAG39295.1. AF208863 mRNA. Translation: AAF64277.1. AK002102 mRNA. Translation: BAA92087.1. AK290069 mRNA. Translation: BAF82758.1. AL583831, AL358133, AL590702 Genomic DNA. Translation: CAH74081.1. AL583831, AL358133, AL590702 Genomic DNA. Translation: CAH74083.1. AL358133, AL583831, AL590702 Genomic DNA. Translation: CAI16835.1. AL358133, AL583831, AL590702 Genomic DNA. Translation: CAI16836.1. AL590702, AL358133, AL583831 Genomic DNA. Translation: CAI17314.1. AL590702, AL358133, AL583831 Genomic DNA. Translation: CAI17316.1. CH471051 Genomic DNA. Translation: EAW48832.1. CH471051 Genomic DNA. Translation: EAW48833.1. CH471051 Genomic DNA. Translation: EAW48835.1. BC010360 mRNA. Translation: AAH10360.1. BC047073 mRNA. Translation: AAH47073.1. AF211480 mRNA. Translation: AAK26247.1. Frameshift. |
| IPI | IPI00020007. IPI00640628. IPI00807437. IPI00871937. |
| RefSeq | NP_060838.3. NM_018368.3. |
| UniGene | Hs.271643. Hs.736005. |
3D structure databases | |
| ProteinModelPortal | Q9NUN5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NUN5. 1 interaction. |
| STRING | 9606.ENSP00000359609. |
Protein family/group databases | |
| TCDB | 9.A.54.1.1. lysosomal cobalamin (B12) transporter (L-B12T) family. |
PTM databases | |
| PhosphoSite | Q9NUN5. |
Polymorphism databases | |
| DMDM | 74752981. |
Proteomic databases | |
| PaxDb | Q9NUN5. |
| PRIDE | Q9NUN5. |
Protocols and materials databases | |
| DNASU | 55788. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370570; ENSP00000359602; ENSG00000168216. ENST00000370577; ENSP00000359609; ENSG00000168216. ENST00000472827; ENSP00000433385; ENSG00000168216. |
| GeneID | 55788. |
| KEGG | hsa:55788. |
| UCSC | uc003pez.3. human. |
Organism-specific databases | |
| CTD | 55788. |
| GeneCards | GC06M070385. |
| HGNC | HGNC:23038. LMBRD1. |
| HPA | HPA019547. |
| MIM | 277380. phenotype. 612625. gene. |
| neXtProt | NX_Q9NUN5. |
| Orphanet | 79284. Methylmalonic acidemia with homocystinuria, type cblF. |
| PharmGKB | PA134948847. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG87911. |
| HOVERGEN | HBG059142. |
| KO | K14617. |
| OMA | ADAPEDQ. |
| OrthoDB | EOG4933HV. |
| PhylomeDB | Q9NUN5. |
Gene expression databases | |
| Bgee | Q9NUN5. |
| CleanEx | HS_LMBRD1. |
| Genevestigator | Q9NUN5. |
| GermOnline | ENSG00000168216. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006876. LMBR1-like_membr_prot. [Graphical view] |
| Pfam | PF04791. LMBR1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LMBRD1. human. |
| GenomeRNAi | 55788. |
| NextBio | 60892. |
| SOURCE | Search... |
Entry information
| Entry name | LMBD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NUN5 Secondary accession number(s): A8K204 Q9NZD6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
