Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NUN5 (LMBD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable lysosomal cobalamin transporter
Alternative name(s):
HDAg-L-interacting protein NESI
LMBR1 domain-containing protein 1
Nuclear export signal-interacting protein
Gene names
Name:LMBRD1
Synonyms:C6orf209, NESI
ORF Names:BM-021, CD001, MSTP044
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length540 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV). Ref.1 Ref.11

Subunit structure

Isoform 3 interacts with Hepatitis delta virus NES(HDAg-L). Ref.1

Subcellular location

Lysosome membrane; Multi-pass membrane protein Ref.11.

Tissue specificity

Isoform 3 is expressed in liver. Ref.1

Post-translational modification

N-glycosylated. Ref.11

Involvement in disease

Methylmalonic aciduria and homocystinuria type cblF (MMAHCF) [MIM:277380]: A disorder of cobalamin metabolism characterized by decreased levels of the coenzymes adenosylcobalamin (AdoCbl) and methylcobalamin (MeCbl). It is due to accumulation of free cobalamin in lysosomes, thus hindering its conversion to cofactors. Clinical features include developmental delay, stomatitis, glossitis, seizures and methylmalonic aciduria responsive to vitamin B12.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11

Sequence similarities

Belongs to the LIMR family. LMBRD1 subfamily.

Sequence caution

The sequence AAK26247.1 differs from that shown. Reason: Frameshift at position 137.

Ontologies

Keywords
   Biological processHost-virus interaction
Transport
   Cellular componentLysosome
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandCobalamin
Cobalt
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcobalamin metabolic process

Traceable author statement. Source: Reactome

transport

Inferred from electronic annotation. Source: UniProtKB-KW

viral process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

lysosomal membrane

Traceable author statement. Source: Reactome

   Molecular_functioncobalamin binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NUN5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NUN5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     362-392: VFPLDYILITIIIMYFIFTSMAGIRNIGIWF → EFEILAYGSFGLDYIKSEEVEPGPKHSFFSA
     393-540: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9NUN5-3)

Also known as: NESI;

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: Missing.
Isoform 4 (identifier: Q9NUN5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-204: Missing.
     362-392: VFPLDYILITIIIMYFIFTSMAGIRNIGIWF → EFEILAYGSFGLDYIKSEEVEPGPKHSFFSA
     393-540: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 540540Probable lysosomal cobalamin transporter
PRO_0000260515

Regions

Topological domain1 – 1010Extracellular Potential
Transmembrane11 – 3121Helical; Name=1; Potential
Topological domain32 – 5019Cytoplasmic Potential
Transmembrane51 – 7121Helical; Name=2; Potential
Topological domain72 – 10029Extracellular Potential
Transmembrane101 – 12121Helical; Name=3; Potential
Topological domain122 – 14423Cytoplasmic Potential
Transmembrane145 – 16521Helical; Name=4; Potential
Topological domain166 – 18823Extracellular Potential
Transmembrane189 – 20921Helical; Name=5; Potential
Topological domain210 – 30596Cytoplasmic Potential
Transmembrane306 – 32621Helical; Name=6; Potential
Topological domain327 – 36438Extracellular Potential
Transmembrane365 – 38521Helical; Name=7; Potential
Topological domain386 – 40823Cytoplasmic Potential
Transmembrane409 – 42921Helical; Name=8; Potential
Topological domain430 – 48657Extracellular Potential
Transmembrane487 – 50721Helical; Name=9; Potential
Topological domain508 – 54033Cytoplasmic Potential

Amino acid modifications

Modified residue2381Phosphothreonine By similarity
Modified residue5281Phosphoserine Ref.9 Ref.12
Modified residue5311Phosphoserine Ref.9 Ref.12
Glycosylation781N-linked (GlcNAc...) Potential
Glycosylation881N-linked (GlcNAc...) Potential
Glycosylation1701N-linked (GlcNAc...) Potential
Glycosylation3471N-linked (GlcNAc...) Potential
Glycosylation4481N-linked (GlcNAc...) Potential
Glycosylation4571N-linked (GlcNAc...) Probable

Natural variations

Alternative sequence1 – 204204Missing in isoform 4.
VSP_036539
Alternative sequence1 – 7373Missing in isoform 3.
VSP_021629
Alternative sequence362 – 39231VFPLD…IGIWF → EFEILAYGSFGLDYIKSEEV EPGPKHSFFSA in isoform 2 and isoform 4.
VSP_021630
Alternative sequence393 – 540148Missing in isoform 2 and isoform 4.
VSP_036540
Natural variant1441T → A.
Corresponds to variant rs12214456 [ dbSNP | Ensembl ].
VAR_029047
Natural variant3951I → V. Ref.7
Corresponds to variant rs17854411 [ dbSNP | Ensembl ].
VAR_029048
Natural variant4691D → E.
Corresponds to variant rs9354880 [ dbSNP | Ensembl ].
VAR_029049

Experimental info

Mutagenesis781N → Q: Does not affect glycosylation status; when associated with Q-88. Ref.11
Mutagenesis881N → Q: Does not affect glycosylation status; when associated with Q-78. Ref.11
Mutagenesis4481N → Q: Affects glycosylation status; when associated with Q-457. Ref.11
Mutagenesis4571N → Q: Affects glycosylation status. Affects glycosylation status; when associated with Q-448. Ref.11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: CC7578B0F5FD7BA6

FASTA54061,389
        10         20         30         40         50         60 
MATSGAASAE LVIGWCIFGL LLLAILAFCW IYVRKYQSRR ESEVVSTITA IFSLAIALIT 

        70         80         90        100        110        120 
SALLPVDIFL VSYMKNQNGT FKDWANANVS RQIEDTVLYG YYTLYSVILF CVFFWIPFVY 

       130        140        150        160        170        180 
FYYEEKDDDD TSKCTQIKTA LKYTLGFVVI CALLLLVGAF VPLNVPNNKN STEWEKVKSL 

       190        200        210        220        230        240 
FEELGSSHGL AALSFSISSL TLIGMLAAIT YTAYGMSALP LNLIKGTRSA AYERLENTED 

       250        260        270        280        290        300 
IEEVEQHIQT IKSKSKDGRP LPARDKRALK QFEERLRTLK KRERHLEFIE NSWWTKFCGA 

       310        320        330        340        350        360 
LRPLKIVWGI FFILVALLFV ISLFLSNLDK ALHSAGIDSG FIIFGANLSN PLNMLLPLLQ 

       370        380        390        400        410        420 
TVFPLDYILI TIIIMYFIFT SMAGIRNIGI WFFWIRLYKI RRGRTRPQAL LFLCMILLLI 

       430        440        450        460        470        480 
VLHTSYMIYS LAPQYVMYGS QNYLIETNIT SDNHKGNSTL SVPKRCDADA PEDQCTVTRT 

       490        500        510        520        530        540 
YLFLHKFWFF SAAYYFGNWA FLGVFLIGLI VSCCKGKKSV IEGVDEDSDI SDDEPSVYSA 

« Hide

Isoform 2 [UniParc].

Checksum: 6DE93B0127AC0BE5
Show »

FASTA39244,211
Isoform 3 (NESI) [UniParc].

Checksum: 51C91051CD071AC5
Show »

FASTA46753,435
Isoform 4 [UniParc].

Checksum: 028B19ED4912A09C
Show »

FASTA18821,394

References

« Hide 'large scale' references
[1]"Novel nuclear export signal-interacting protein, NESI, critical for the assembly of hepatitis delta virus."
Wang Y.-H., Chang S.C., Huang C., Li Y.-P., Lee C.-H., Chang M.-F.
J. Virol. 79:8113-8120(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH HDAG-L.
[2]Liu B., Liu Y.Q., Wang X.Y., Zhao B., Sheng H., Zhao X.W., Liu S., Xu Y.Y., Ye J., Song L., Gao Y., Zhang C.L., Zhang J., Wei Y.J., Cao H.Q., Zhao Y., Liu L.S., Ding J.F. expand/collapse author list , Gao R.L., Wu Q.Y., Qiang B.Q., Yuan J.G., Liew C.C., Zhao M.S., Hui R.T.
Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Heart.
[3]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Bone marrow.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Placenta and Substantia nigra.
[5]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-395.
Tissue: Brain.
[8]"A novel gene expressed in human pheochromocytoma."
Li N., Song H., Peng Y., Xiao H., Han Z., Chen Z.
Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 130-540 (ISOFORMS 1/3).
Tissue: Pheochromocytoma.
[9]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-528 AND SER-531, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Identification of a putative lysosomal cobalamin exporter altered in the cblF defect of vitamin B12 metabolism."
Rutsch F., Gailus S., Miousse I.R., Suormala T., Sagne C., Toliat M.R., Nuernberg G., Wittkampf T., Buers I., Sharifi A., Stucki M., Becker C., Baumgartner M., Robenek H., Marquardt T., Hoehne W., Gasnier B., Rosenblatt D.S., Fowler B., Nuernberg P.
Nat. Genet. 41:234-239(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN MMAHCF, FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, GLYCOSYLATION, MUTAGENESIS OF ASN-78; ASN-88; ASN-448 AND ASN-457.
[12]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-528 AND SER-531, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY136817 mRNA. Translation: AAN11301.1.
AF113224 mRNA. Translation: AAG39295.1.
AF208863 mRNA. Translation: AAF64277.1.
AK002102 mRNA. Translation: BAA92087.1.
AK290069 mRNA. Translation: BAF82758.1.
AL583831, AL358133, AL590702 Genomic DNA. Translation: CAH74081.1.
AL583831, AL358133, AL590702 Genomic DNA. Translation: CAH74083.1.
AL358133, AL583831, AL590702 Genomic DNA. Translation: CAI16835.1.
AL358133, AL583831, AL590702 Genomic DNA. Translation: CAI16836.1.
AL590702, AL358133, AL583831 Genomic DNA. Translation: CAI17314.1.
AL590702, AL358133, AL583831 Genomic DNA. Translation: CAI17316.1.
CH471051 Genomic DNA. Translation: EAW48832.1.
CH471051 Genomic DNA. Translation: EAW48833.1.
CH471051 Genomic DNA. Translation: EAW48835.1.
BC010360 mRNA. Translation: AAH10360.1.
BC047073 mRNA. Translation: AAH47073.1.
AF211480 mRNA. Translation: AAK26247.1. Frameshift.
RefSeqNP_060838.3. NM_018368.3.
UniGeneHs.271643.
Hs.736005.

3D structure databases

ProteinModelPortalQ9NUN5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120902. 2 interactions.
IntActQ9NUN5. 1 interaction.
STRING9606.ENSP00000359609.

Protein family/group databases

TCDB9.A.54.1.1. the lysosomal cobalamin (b12) transporter (l-b12t) family.

PTM databases

PhosphoSiteQ9NUN5.

Polymorphism databases

DMDM74752981.

Proteomic databases

PaxDbQ9NUN5.
PRIDEQ9NUN5.

Protocols and materials databases

DNASU55788.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000370570; ENSP00000359602; ENSG00000168216. [Q9NUN5-3]
ENST00000370577; ENSP00000359609; ENSG00000168216. [Q9NUN5-1]
ENST00000472827; ENSP00000433385; ENSG00000168216. [Q9NUN5-2]
GeneID55788.
KEGGhsa:55788.
UCSCuc003pez.3. human. [Q9NUN5-1]

Organism-specific databases

CTD55788.
GeneCardsGC06M070385.
HGNCHGNC:23038. LMBRD1.
HPAHPA019547.
MIM277380. phenotype.
612625. gene.
neXtProtNX_Q9NUN5.
Orphanet79284. Methylmalonic acidemia with homocystinuria, type cblF.
PharmGKBPA134948847.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG87911.
HOVERGENHBG059142.
KOK14617.
OMACTQIKTA.
OrthoDBEOG7BKCTF.
PhylomeDBQ9NUN5.
TreeFamTF329170.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_116125. Disease.

Gene expression databases

BgeeQ9NUN5.
CleanExHS_LMBRD1.
GenevestigatorQ9NUN5.

Family and domain databases

InterProIPR006876. LMBR1-like_membr_prot.
[Graphical view]
PfamPF04791. LMBR1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLMBRD1. human.
GeneWikiLMBRD1.
GenomeRNAi55788.
NextBio60892.
PROQ9NUN5.
SOURCESearch...

Entry information

Entry nameLMBD1_HUMAN
AccessionPrimary (citable) accession number: Q9NUN5
Secondary accession number(s): A8K204 expand/collapse secondary AC list , E1P531, Q5VUN6, Q86Y70, Q96FW4, Q9BY56, Q9NZD6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: October 1, 2000
Last modified: March 19, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM