Q9NUL3 (STAU2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-binding protein Staufen homolog 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 570 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body By similarity. |
| Subunit structure | Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP. Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation By similarity. Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. |
| Subcellular location | Cytoplasm. Nucleus. Nucleus › nucleolus. Endoplasmic reticulum. Note: Shuttles between the nucleolus, nucleus and the cytoplasm. Nuclear export of isoform 1 is independent of XPO1/CRM1 and requires the exportin XPO5. Nuclear export of isoform 2 and isoform 3 can occur by both XPO1/CRM1-dependent and XPO1/CRM1-independent pathways. Found in large cytoplasmic ribonucleoprotein (RNP) granules which are present in the actin rich regions of myelinating processes and associated with microtubules, polysomes and the endoplasmic reticulum. Also recruited to stress granules (SGs) upon inhibition of translation or oxidative stress. These structures are thought to harbor housekeeping mRNAs when translation is aborted By similarity. |
| Domain | The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export By similarity. |
| Sequence similarities | Contains 4 DRBM (double-stranded RNA-binding) domains. |
| Sequence caution | The sequence BAA91766.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14522.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cytoplasm Endoplasmic reticulum Microtubule Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell microtubuleInferred from electronic annotation. Source: UniProtKB-KW nucleolusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | double-stranded RNA binding Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NUL3-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NUL3-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ | ||||||
| Isoform 3 (identifier: Q9NUL3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ 511-511: A → V 512-570: Missing. | ||||||
| Isoform 4 (identifier: Q9NUL3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-197: Missing. 511-511: A → V 512-570: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9NUL3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ 138-570: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 570 | 570 | Double-stranded RNA-binding protein Staufen homolog 2 | PRO_0000072246 | |||||
Regions | |||||||||
| Domain | 8 – 75 | 68 | DRBM 1 | ||||||
| Domain | 95 – 181 | 87 | DRBM 2 | ||||||
| Domain | 207 – 274 | 68 | DRBM 3 | ||||||
| Domain | 307 – 375 | 69 | DRBM 4 | ||||||
| Region | 381 – 570 | 190 | Required for dendritic transport By similarity | ||||||
| Motif | 273 – 291 | 19 | Nuclear localization signal 1 By similarity | ||||||
| Motif | 373 – 412 | 40 | Nuclear localization signal 2 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 188 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 416 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 | ||||||
| Modified residue | 440 | 1 | Phosphoserine Ref.7 Ref.9 Ref.10 Ref.13 | ||||||
| Modified residue | 455 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 485 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 486 | 1 | Phosphoserine Ref.10 Ref.11 | ||||||
| Modified residue | 488 | 1 | Phosphothreonine Ref.10 Ref.11 | ||||||
| Modified residue | 492 | 1 | Phosphoserine Ref.10 Ref.11 Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 197 | 197 | Missing in isoform 4. | VSP_015373 | |||||
| Alternative sequence | 1 – 38 | 38 | MANPK…PAHSK → MLQINQ in isoform 2, isoform 3 and isoform 5. | VSP_015374 | |||||
| Alternative sequence | 138 – 570 | 433 | Missing in isoform 5. | VSP_015375 | |||||
| Alternative sequence | 511 | 1 | A → V in isoform 3 and isoform 4. | VSP_015376 | |||||
| Alternative sequence | 512 – 570 | 59 | Missing in isoform 3 and isoform 4. | VSP_015377 | |||||
| Natural variant | 198 | 1 | M → V. Ref.5 Corresponds to variant rs949493 [ dbSNP | Ensembl ]. | VAR_023394 | |||||
Experimental info | |||||||||
| Sequence conflict | 433 | 1 | G → D in CAH10527. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel homolog of the Drosophila staufen protein in the chromosome 8q13-q21.1 region." Buchner G., Bassi M.T., Andolfi G., Ballabio A., Franco B. Genomics 62:113-118(1999) [PubMed: 10585778] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [2] | "Staufen2 isoforms localize to the somatodendritic domain of neurons and interact with different organelles." Duchaine T.F., Hemraj I., Furic L., Deitinghoff A., Kiebler M.A., DesGroseillers L. J. Cell Sci. 115:3285-3295(2002) [PubMed: 12140260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 256-570 (ISOFORMS 3/4). Tissue: Ovary, Placenta and Teratocarcinoma. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Retina. |
| [5] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-198. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5). Tissue: Urinary bladder carcinoma. |
| [7] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-440, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-416, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188; SER-416; SER-440 AND SER-455, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-416; SER-440; SER-455; SER-486; THR-488 AND SER-492, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-485; SER-486; THR-488 AND SER-492, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [12] | "Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs." Weidensdorfer D., Stoehr N., Baude A., Lederer M., Koehn M., Schierhorn A., Buchmeier S., Wahle E., Huettelmaiery S. RNA 15:104-115(2009) [PubMed: 19029303] [Abstract] Cited for: IDENTIFICATION IN A MRNP COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-440 AND SER-492, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y19062 mRNA. Translation: CAB64341.1. AF459097 mRNA. Translation: AAN37926.1. AF459098 mRNA. Translation: AAN37927.1. AK001576 mRNA. Translation: BAA91766.1. Different initiation. AK002152 mRNA. Translation: BAA92111.1. AK023314 mRNA. Translation: BAB14522.1. Different initiation. CR627442 mRNA. Translation: CAH10527.1. AC027018 Genomic DNA. No translation available. AC100784 Genomic DNA. No translation available. BC008369 mRNA. Translation: AAH08369.1. BC008370 mRNA. Translation: AAH08370.1. |
| IPI | IPI00164481. IPI00300789. IPI00644696. IPI01009003. IPI01009624. |
| RefSeq | NP_001157852.1. NM_001164380.1. NP_001157853.1. NM_001164381.1. NP_001157854.1. NM_001164382.1. NP_001157855.1. NM_001164383.1. NP_001157856.1. NM_001164384.1. NP_001157857.1. NM_001164385.1. NP_055208.2. NM_014393.2. |
| UniGene | Hs.561815. |
3D structure databases | |
| ProteinModelPortal | Q9NUL3. |
| SMR | Q9NUL3. Positions 4-78, 95-181, 203-389. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NUL3. 3 interactions. |
| MINT | MINT-1426106. |
| STRING | Q9NUL3. |
PTM databases | |
| PhosphoSite | Q9NUL3. |
Polymorphism databases | |
| DMDM | 73919458. |
Proteomic databases | |
| PRIDE | Q9NUL3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000418363; ENSP00000389932; ENSG00000040341. |
| GeneID | 27067. |
| KEGG | hsa:27067. |
| UCSC | uc003xzm.2. human. uc003xzr.2. human. |
Organism-specific databases | |
| CTD | 27067. |
| GeneCards | GC08M074332. |
| H-InvDB | HIX0007585. |
| HGNC | HGNC:11371. STAU2. |
| HPA | CAB020836. HPA019155. |
| MIM | 605920. gene. |
| neXtProt | NX_Q9NUL3. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00530000063014. |
| HOGENOM | HBG713249. |
| HOVERGEN | HBG005013. |
| InParanoid | Q9NUL3. |
| OrthoDB | EOG44F68V. |
Gene expression databases | |
| ArrayExpress | Q9NUL3. |
| CleanEx | HS_STAU2. |
| Genevestigator | Q9NUL3. |
| GermOnline | ENSG00000040341. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like. [Graphical view] |
| Gene3D | G3DSA:3.30.160.20. dsRNA-bd-like. 4 hits. |
| Pfam | PF00035. dsrm. 4 hits. [Graphical view] |
| SMART | SM00358. DSRM. 4 hits. [Graphical view] |
| PROSITE | PS50137. DS_RBD. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 49639. |
| SOURCE | Search... |
Entry information
| Entry name | STAU2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NUL3 Secondary accession number(s): Q6AHY7 Q9UGG6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with