Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Double-stranded RNA-binding protein Staufen homolog 2

Gene

STAU2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body (By similarity).By similarity

GO - Molecular functioni

  • double-stranded RNA binding Source: MGI
  • RNA binding Source: UniProtKB

Keywordsi

Molecular functionRNA-binding
Biological processTransport

Names & Taxonomyi

Protein namesi
Recommended name:
Double-stranded RNA-binding protein Staufen homolog 2
Gene namesi
Name:STAU2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000040341.17
HGNCiHGNC:11371 STAU2
MIMi605920 gene
neXtProtiNX_Q9NUL3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi27067
OpenTargetsiENSG00000040341
PharmGKBiPA36189

Polymorphism and mutation databases

BioMutaiSTAU2
DMDMi73919458

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000722461 – 570Double-stranded RNA-binding protein Staufen homolog 2Add BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei188PhosphoserineCombined sources1
Modified residuei395PhosphoserineCombined sources1
Modified residuei405PhosphothreonineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei426PhosphoserineCombined sources1
Modified residuei440PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1
Modified residuei492PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NUL3
MaxQBiQ9NUL3
PaxDbiQ9NUL3
PeptideAtlasiQ9NUL3
PRIDEiQ9NUL3
ProteomicsDBi82683
82684 [Q9NUL3-2]
82685 [Q9NUL3-3]
82686 [Q9NUL3-4]
82687 [Q9NUL3-5]

PTM databases

iPTMnetiQ9NUL3
PhosphoSitePlusiQ9NUL3

Expressioni

Gene expression databases

BgeeiENSG00000040341
CleanExiHS_STAU2
ExpressionAtlasiQ9NUL3 baseline and differential
GenevisibleiQ9NUL3 HS

Organism-specific databases

HPAiCAB020836
HPA019155

Interactioni

Subunit structurei

Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP. Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation (By similarity). Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. Interacts with TRIM71 (via NHL repeats) in an RNA-dependent manner (PubMed:23125361).By similarity2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi117978, 59 interactors
IntActiQ9NUL3, 21 interactors
MINTiQ9NUL3
STRINGi9606.ENSP00000428756

Structurei

3D structure databases

ProteinModelPortaliQ9NUL3
SMRiQ9NUL3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 75DRBM 1PROSITE-ProRule annotationAdd BLAST68
Domaini95 – 181DRBM 2PROSITE-ProRule annotationAdd BLAST87
Domaini207 – 274DRBM 3PROSITE-ProRule annotationAdd BLAST68
Domaini307 – 375DRBM 4PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni381 – 570Required for dendritic transportBy similarityAdd BLAST190

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi273 – 291Nuclear localization signal 1By similarityAdd BLAST19
Motifi373 – 412Nuclear localization signal 2By similarityAdd BLAST40

Domaini

The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export (By similarity).By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3732 Eukaryota
ENOG410XSCK LUCA
GeneTreeiENSGT00900000140998
HOGENOMiHOG000231025
HOVERGENiHBG005013
InParanoidiQ9NUL3
KOiK17597
OMAiQRYHCPV
OrthoDBiEOG091G07A0
PhylomeDBiQ9NUL3
TreeFamiTF350296

Family and domain databases

InterProiView protein in InterPro
IPR014720 dsRBD_dom
IPR032478 Staufen_C
PfamiView protein in Pfam
PF00035 dsrm, 4 hits
PF16482 Staufen_C, 1 hit
SMARTiView protein in SMART
SM00358 DSRM, 4 hits
PROSITEiView protein in PROSITE
PS50137 DS_RBD, 4 hits

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NUL3-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANPKEKTAM CLVNELARFN RVQPQYKLLN ERGPAHSKMF SVQLSLGEQT
60 70 80 90 100
WESEGSSIKK AQQAVANKAL TESTLPKPVQ KPPKSNVNNN PGSITPTVEL
110 120 130 140 150
NGLAMKRGEP AIYRPLDPKP FPNYRANYNF RGMYNQRYHC PVPKIFYVQL
160 170 180 190 200
TVGNNEFFGE GKTRQAARHN AAMKALQALQ NEPIPERSPQ NGESGKDVDD
210 220 230 240 250
DKDANKSEIS LVFEIALKRN MPVSFEVIKE SGPPHMKSFV TRVSVGEFSA
260 270 280 290 300
EGEGNSKKLS KKRAATTVLQ ELKKLPPLPV VEKPKLFFKK RPKTIVKAGP
310 320 330 340 350
EYGQGMNPIS RLAQIQQAKK EKEPDYVLLS ERGMPRRREF VMQVKVGNEV
360 370 380 390 400
ATGTGPNKKI AKKNAAEAML LQLGYKASTN LQDQLEKTGE NKGWSGPKPG
410 420 430 440 450
FPEPTNNTPK GILHLSPDVY QEMEASRHKV ISGTTLGYLS PKDMNQPSSS
460 470 480 490 500
FFSISPTSNS SATIARELLM NGTSSTAEAI GLKGSSPTPP CSPVQPSKQL
510 520 530 540 550
EYLARIQGFQ AALSALKQFS EQGLDPIDGA MNIEKGSLEK QAKHLREKAD
560 570
NNQAPPGSIA QDCKKSNSAV
Length:570
Mass (Da):62,608
Last modified:March 28, 2018 - v2
Checksum:i0F07B59D9456D9FA
GO
Isoform 2 (identifier: Q9NUL3-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ

Show »
Length:538
Mass (Da):58,970
Checksum:i231B73DD889F7111
GO
Isoform 3 (identifier: Q9NUL3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ
     511-511: A → V
     512-570: Missing.

Show »
Length:479
Mass (Da):52,737
Checksum:iAE7187740BA310E9
GO
Isoform 4 (identifier: Q9NUL3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-220: Missing.
     511-511: A → V
     512-570: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:291
Mass (Da):31,724
Checksum:i868EDBC3CFDB7840
GO
Isoform 5 (identifier: Q9NUL3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSK → MLQINQ
     138-570: Missing.

Show »
Length:105
Mass (Da):11,763
Checksum:i581E40C45AE59FDC
GO
Isoform 6 (identifier: Q9NUL3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: Missing.

Note: No experimental confirmation available.
Show »
Length:398
Mass (Da):43,278
Checksum:iD3596C80A0DFF202
GO
Isoform 7 (identifier: Q9NUL3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     509-509: F → FQVHYCDRQSGKECVTCLTLAPVQMTFHAIGSSIEASHD

Note: No experimental confirmation available.
Show »
Length:504
Mass (Da):55,414
Checksum:iCA38078E7E7DA03A
GO
Isoform 8 (identifier: Q9NUL3-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     511-570: AALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV → V

Note: No experimental confirmation available.
Show »
Length:473
Mass (Da):52,009
Checksum:i7C7FD9481840C355
GO

Sequence cautioni

The sequence BAA91766 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14522 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH10527 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti345K → T in BAH11778 (PubMed:14702039).Curated1
Sequence conflicti433G → D in CAH10527 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023394198V → M5 PublicationsCorresponds to variant dbSNP:rs949493Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0153731 – 220Missing in isoform 4. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_0461381 – 172Missing in isoform 6. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_0461391 – 104Missing in isoform 7. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_0153741 – 38MANPK…PAHSK → MLQINQ in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST38
Alternative sequenceiVSP_0461401 – 38Missing in isoform 8. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_015375138 – 570Missing in isoform 5. 1 PublicationAdd BLAST433
Alternative sequenceiVSP_046141509F → FQVHYCDRQSGKECVTCLTL APVQMTFHAIGSSIEASHD in isoform 7. 1 Publication1
Alternative sequenceiVSP_046142511 – 570AALSA…SNSAV → V in isoform 8. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_015376511A → V in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_015377512 – 570Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y19062 mRNA Translation: CAB64341.1
AF459097 mRNA Translation: AAN37926.1
AF459098 mRNA Translation: AAN37927.1
AK001576 mRNA Translation: BAA91766.1 Different initiation.
AK002152 mRNA Translation: BAA92111.1
AK023314 mRNA Translation: BAB14522.1 Different initiation.
AK293496 mRNA Translation: BAH11522.1
AK294466 mRNA Translation: BAH11778.1
AK303104 mRNA Translation: BAH13900.1
CR627442 mRNA Translation: CAH10527.1 Different initiation.
AC018620 Genomic DNA No translation available.
AC027018 Genomic DNA No translation available.
AC100784 Genomic DNA No translation available.
KF458781 Genomic DNA No translation available.
BC008369 mRNA Translation: AAH08369.1
BC008370 mRNA Translation: AAH08370.1
CCDSiCCDS55244.1 [Q9NUL3-6]
CCDS55245.1 [Q9NUL3-7]
CCDS55246.1 [Q9NUL3-8]
CCDS55247.1 [Q9NUL3-1]
CCDS55248.1 [Q9NUL3-2]
CCDS6214.1 [Q9NUL3-3]
RefSeqiNP_001157852.1, NM_001164380.1 [Q9NUL3-1]
NP_001157853.1, NM_001164381.1 [Q9NUL3-2]
NP_001157854.1, NM_001164382.1 [Q9NUL3-7]
NP_001157855.1, NM_001164383.1 [Q9NUL3-6]
NP_001157856.1, NM_001164384.1 [Q9NUL3-3]
NP_001157857.1, NM_001164385.1 [Q9NUL3-8]
NP_055208.2, NM_014393.2 [Q9NUL3-3]
UniGeneiHs.561815

Genome annotation databases

EnsembliENST00000355780; ENSP00000348026; ENSG00000040341 [Q9NUL3-3]
ENST00000517542; ENSP00000431111; ENSG00000040341 [Q9NUL3-8]
ENST00000521210; ENSP00000429173; ENSG00000040341 [Q9NUL3-7]
ENST00000521451; ENSP00000428476; ENSG00000040341 [Q9NUL3-4]
ENST00000522509; ENSP00000427977; ENSG00000040341 [Q9NUL3-3]
ENST00000522695; ENSP00000428456; ENSG00000040341 [Q9NUL3-2]
ENST00000523558; ENSP00000428741; ENSG00000040341 [Q9NUL3-6]
ENST00000524104; ENSP00000430611; ENSG00000040341 [Q9NUL3-5]
ENST00000524300; ENSP00000428756; ENSG00000040341 [Q9NUL3-1]
GeneIDi27067
KEGGihsa:27067
UCSCiuc003xzs.5 human [Q9NUL3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSTAU2_HUMAN
AccessioniPrimary (citable) accession number: Q9NUL3
Secondary accession number(s): A0A0A0MTC5
, B7Z1I6, B7Z292, B7Z8B4, E7ER74, E9PEI3, E9PF26, E9PF50, Q6AHY7, Q96HM0, Q96HM1, Q9NVI5, Q9UGG6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: March 28, 2018
Last modified: June 20, 2018
This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health