Reviewed,
UniProtKB/Swiss-Prot Q9NUI1 (DECR2_HUMAN)
Last modified
June 16, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Peroxisomal 2,4-dienoyl-CoA reductase Short name=pDCR EC=1.3.1.34 Alternative name(s): 2,4-dienoyl-CoA reductase 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 292 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid. |
| Catalytic activity | Trans-2,3-didehydroacyl-CoA + NADP+ = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH. Ref.1 |
| Subcellular location | Peroxisome By similarity. |
| Sequence similarities | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily. |
| biophysicochemical properties | Kinetic parameters: KM=59 µM for 2,4-hexadienoyl-CoA KM=6 µM for 2,4-decadienoyl-CoA KM=102 µM for 2,4,7,10,13,16,19-docosaheptaenoyl-CoA |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Peroxisome |
| Coding sequence diversity | Alternative splicing |
| Ligand | NADP |
| Molecular function | Oxidoreductase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | oxidation reduction Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | peroxisome Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | 2,4-dienoyl-CoA reductase (NADPH) activity Inferred from electronic annotation. Source: EC bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NUI1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NUI1-2) The sequence of this isoform differs from the canonical sequence as follows: 50-50: R → RASEDQMGHCSSSGTCLAGVATFMVIVGKQPPNQKSRETKEQGRQIPFVCVR 114-160: AAGNFLCPAG...KFFRDHGGVI → SSSSCGLPFC...RHLQCVSCAL 161-292: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NUI1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-48: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 292 | 292 | Peroxisomal 2,4-dienoyl-CoA reductase | PRO_0000054559 | |||||
Regions | |||||||||
| Nucleotide binding | 33 – 57 | 25 | NADP By similarity | ||||||
| Motif | 290 – 292 | 3 | Microbody targeting signal By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 59 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 61 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 48 | 48 | Missing in isoform 3. | VSP_013629 | |||||
| Alternative sequence | 50 | 1 | R → RASEDQMGHCSSSGTCLAGV ATFMVIVGKQPPNQKSRETK EQGRQIPFVCVR in isoform 2. | VSP_013630 | |||||
| Alternative sequence | 114 – 160 | 47 | AAGNF…HGGVI → SSSSCGLPFCRCGRELPVPR WRLVLQRLQDRDGHRYQRHL QCVSCAL in isoform 2. | VSP_013631 | |||||
| Alternative sequence | 161 – 292 | 132 | Missing in isoform 2. | VSP_013632 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterisation of human peroxisomal 2,4-dienoyl-CoA reductase." De Nys K., Meyhi E., Mannaerts G.P., Fransen M., Van Veldhoven P.P. Biochim. Biophys. Acta 1533:66-72(2001) [PubMed: 11514237] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES. |
| [2] | "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16." Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R. Hum. Mol. Genet. 10:339-352(2001) [PubMed: 11157797] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Lung. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-59 AND SER-61, MASS SPECTROMETRY. Tissue: Epithelium. |
Cross-references
Sequence databases | |
|---|---|
| AJ293009 mRNA. Translation: CAC05664.1. AE006463 Genomic DNA. Translation: AAK61231.1. AK128012 mRNA. Translation: BAC87232.1. AL023881 Genomic DNA. Translation: CAB92744.1. BC010740 mRNA. Translation: AAH10740.1. BC011968 mRNA. Translation: AAH11968.1. | |
| IPI | IPI00010190. IPI00444050. IPI00640806. |
| RefSeq | NP_065715.1. |
| UniGene | Hs.655999 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1G0N based on UniProtKB Q12634. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9NUI1. |
Genome annotation databases | |
| Ensembl | ENSG00000103202. Homo sapiens. [Contig view] |
| GeneID | 26063. |
| KEGG | hsa:26063. |
Organism-specific databases | |
| GeneCards | GC16P000391. |
| H-InvDB | HIX0012648. HIX0079832. |
| HGNC | HGNC:2754. DECR2. |
| PharmGKB | PA27235. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9NUI1. |
| HOVERGEN | Q9NUI1. |
| OMA | Q9NUI1. ILINCSS. |
Enzyme and pathway databases | |
| BRENDA | 1.3.1.34. 247. |
Gene expression databases | |
| ArrayExpress | Q9NUI1. |
| Bgee | Q9NUI1. |
| CleanEx | HS_DECR2. |
| GermOnline | ENSG00000103202. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002198. DH_sc/Rdtase_SDR. IPR002347. Glc/ribitol_DH. IPR016040. NAD(P)-bd_dom. [Graphical view] |
| Gene3D | G3DSA:3.40.50.720. NAD(P)-bd. 1 hit. |
| PANTHER | PTHR19410. ADH_short_C2. 1 hit. |
| Pfam | PF00106. adh_short. 1 hit. [Graphical view] |
| PRINTS | PR00081. GDHRDH. PR00080. SDRFAMILY. |
| PROSITE | PS00061. ADH_SHORT. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 47965. |
Entry information
| Entry name | DECR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NUI1 Secondary accession number(s): Q6ZRS7, Q96ET0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


