Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NU63

- ZFP57_HUMAN

UniProt

Q9NU63 - ZFP57_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 57 homolog

Gene

ZFP57

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element By similarity. Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells.By similarity1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei185 – 1851Crucial for 5-methylcytosine recognitionBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri91 – 11323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri119 – 14123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri147 – 16923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri175 – 19723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri300 – 32223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri328 – 35023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri356 – 37823C2H2-type 7; degeneratePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. DNA methylation involved in embryo development Source: UniProtKB
  2. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  3. peripheral nervous system development Source: Ensembl
  4. regulation of gene expression by genetic imprinting Source: UniProtKB
  5. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 57 homolog
Short name:
Zfp-57
Alternative name(s):
Zinc finger protein 698
Gene namesi
Name:ZFP57
Synonyms:C6orf40, ZNF698
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:18791. ZFP57.

Subcellular locationi

Nucleus By similarity
Note: Binds various differentially methylated regions (DMR), including the SNRPN DMR.By similarity

GO - Cellular componenti

  1. nuclear heterochromatin Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Transient neonatal diabetes mellitus 1 (TNDM1) [MIM:601410]: Neonatal diabetes is a form of diabetes mellitus defined by the onset of mild-to-severe hyperglycemia within the first months of life. In about half of the neonates, diabetes is transient and resolves at a median age of 3 months, whereas the rest have a permanent form of diabetes.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti166 – 1661R → H in TNDM1. 1 Publication
VAR_054771
Natural varianti193 – 1931H → N in TNDM1. 1 Publication
VAR_054772
Natural varianti374 – 3741H → D in TNDM1. 1 Publication
VAR_054773

Keywords - Diseasei

Diabetes mellitus, Disease mutation

Organism-specific databases

MIMi601410. phenotype.
Orphaneti99886. Transient neonatal diabetes mellitus.
PharmGKBiPA134937821.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 452452Zinc finger protein 57 homologPRO_0000291964Add
BLAST

Proteomic databases

PaxDbiQ9NU63.
PRIDEiQ9NU63.

PTM databases

PhosphoSiteiQ9NU63.

Expressioni

Gene expression databases

BgeeiQ9NU63.
CleanExiHS_ZFP57.
GenevestigatoriQ9NU63.

Organism-specific databases

HPAiHPA047172.

Interactioni

Protein-protein interaction databases

BioGridi131375. 4 interactions.
STRINGi9606.ENSP00000412932.

Structurei

3D structure databases

ProteinModelPortaliQ9NU63.
SMRiQ9NU63. Positions 16-56, 90-381.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini16 – 8873KRABPROSITE-ProRule annotationAdd
BLAST

Domaini

The KRAB domain is required for function as transcriptional repressor.By similarity
Zinc fingers 3 and 4 mediate recognition of the target element, ZF3 interacting with the 5' half (TGC) and ZF4 interacting with the 3' half (CGC).By similarity

Sequence similaritiesi

Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri91 – 11323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri119 – 14123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri147 – 16923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri175 – 19723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri300 – 32223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri328 – 35023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri356 – 37823C2H2-type 7; degeneratePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG267305.
GeneTreeiENSGT00390000002599.
HOGENOMiHOG000155778.
HOVERGENiHBG108764.
InParanoidiQ9NU63.
KOiK09228.
OMAiLLDVNHA.
OrthoDBiEOG7KM5S9.
PhylomeDBiQ9NU63.
TreeFamiTF337947.

Family and domain databases

Gene3Di3.30.160.60. 6 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NU63-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAGEPRSLL FFQKPVTFED VAVNFTQEEW DCLDASQRVL YQDVMSETFK
60 70 80 90 100
NLTSVARIFL HKPELITKLE QEEEQWRETR VLQASQAGPP FFCYTCGKCF
110 120 130 140 150
SRRSYLYSHQ FVHNPKLTNS CSQCGKLFRS PKSLSYHRRM HLGERPFCCT
160 170 180 190 200
LCDKTYCDAS GLSRHRRVHL GYRPHSCSVC GKSFRDQSEL KRHQKIHQNQ
210 220 230 240 250
EPVDGNQECT LRIPGTQAEF QTPIARSQRS IQGLLDVNHA PVARSQEPIF
260 270 280 290 300
RTEGPMAQNQ ASVLKNQAPV TRTQAPITGT LCQDARSNSH PVKPSRLNVF
310 320 330 340 350
CCPHCSLTFS KKSYLSRHQK AHLTEPPNYC FHCSKSFSSF SRLVRHQQTH
360 370 380 390 400
WKQKSYLCPI CDLSFGEKEG LMDHWRGYKG KDLCQSSHHK CRVILGQWLG
410 420 430 440 450
FSHDVPTMAG EEWKHGGDQS PPRIHTPRRR GLREKACKGD KTKEAVSILK

HK
Length:452
Mass (Da):51,919
Last modified:June 26, 2007 - v2
Checksum:i6B285B7FB9ABB3BA
GO
Isoform 2 (identifier: Q9NU63-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MAAGEPRSLLFFQ → MFEQLKPIEPRDCWREARVKK
     78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR

Show »
Length:516
Mass (Da):59,176
Checksum:iC38B9572533B81AE
GO
Isoform 3 (identifier: Q9NU63-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MAAGEPRSLLFFQ → MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKK
     78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR

Note: No experimental confirmation available.

Show »
Length:536
Mass (Da):61,358
Checksum:i0DB8D7F9FCCF4D67
GO

Sequence cautioni

The sequence CAQ10094.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti151 – 1511L → F in AAI57879. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti114 – 1141N → S.
Corresponds to variant rs9461544 [ dbSNP | Ensembl ].
VAR_032902
Natural varianti166 – 1661R → H in TNDM1. 1 Publication
VAR_054771
Natural varianti193 – 1931H → N in TNDM1. 1 Publication
VAR_054772
Natural varianti284 – 2841D → V.1 Publication
Corresponds to variant rs2535241 [ dbSNP | Ensembl ].
VAR_032903
Natural varianti374 – 3741H → D in TNDM1. 1 Publication
VAR_054773

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1313MAAGE…LLFFQ → MFEQLKPIEPRDCWREARVK K in isoform 2. CuratedVSP_026329Add
BLAST
Alternative sequencei1 – 1313MAAGE…LLFFQ → MFEQLKPIEPVQKTLPWVGE VAATLQEAMKRDCWREARVK K in isoform 3. 1 PublicationVSP_036659Add
BLAST
Alternative sequencei78 – 781E → EFVHLPNTEGLSEGKKKELR EQHPSLRDEGTSDDKVFLAC RGAGQCPLSAPAGTMDR in isoform 2 and isoform 3. 1 PublicationVSP_026330

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL050328 Genomic DNA. Translation: CAB89275.2.
AL669813 Genomic DNA. Translation: CAI17624.2.
AL645936 Genomic DNA. Translation: CAI18028.2.
AL929591 Genomic DNA. Translation: CAI41919.2.
BX927250 Genomic DNA. Translation: CAQ10717.1.
BX120002 Genomic DNA. Translation: CAI95569.2.
CR759766 Genomic DNA. Translation: CAQ06621.1.
CR388408 Genomic DNA. Translation: CAQ08216.1.
CR936483 Genomic DNA. Translation: CAQ10094.1. Sequence problems.
BC157878 mRNA. Translation: AAI57879.1.
CCDSiCCDS43436.2. [Q9NU63-3]
RefSeqiNP_001103279.2. NM_001109809.2. [Q9NU63-3]
XP_006725548.1. XM_006725485.1. [Q9NU63-3]
XP_006725549.1. XM_006725486.1. [Q9NU63-3]
UniGeneiHs.156326.

Genome annotation databases

EnsembliENST00000376881; ENSP00000366078; ENSG00000204644. [Q9NU63-1]
ENST00000376883; ENSP00000366080; ENSG00000204644. [Q9NU63-2]
ENST00000383628; ENSP00000373124; ENSG00000206510. [Q9NU63-2]
ENST00000416974; ENSP00000396462; ENSG00000223858. [Q9NU63-2]
ENST00000435906; ENSP00000412932; ENSG00000226858. [Q9NU63-2]
ENST00000437216; ENSP00000398086; ENSG00000223852. [Q9NU63-2]
ENST00000446005; ENSP00000394222; ENSG00000234669. [Q9NU63-2]
ENST00000448114; ENSP00000409118; ENSG00000232099. [Q9NU63-2]
ENST00000488757; ENSP00000418259; ENSG00000204644. [Q9NU63-3]
ENST00000547542; ENSP00000447492; ENSG00000223852. [Q9NU63-1]
ENST00000547911; ENSP00000449556; ENSG00000234669. [Q9NU63-1]
ENST00000548001; ENSP00000446541; ENSG00000232099. [Q9NU63-1]
ENST00000548337; ENSP00000449407; ENSG00000232099. [Q9NU63-3]
ENST00000548574; ENSP00000446798; ENSG00000223852. [Q9NU63-3]
ENST00000548769; ENSP00000448351; ENSG00000206510. [Q9NU63-3]
ENST00000549167; ENSP00000449230; ENSG00000226858. [Q9NU63-3]
ENST00000549501; ENSP00000447698; ENSG00000226858. [Q9NU63-1]
ENST00000552809; ENSP00000450279; ENSG00000223858. [Q9NU63-3]
ENST00000552898; ENSP00000450397; ENSG00000223858. [Q9NU63-1]
ENST00000552987; ENSP00000448634; ENSG00000206510. [Q9NU63-1]
ENST00000553137; ENSP00000447495; ENSG00000234669. [Q9NU63-3]
GeneIDi346171.
KEGGihsa:346171.
UCSCiuc011dlw.2. human. [Q9NU63-3]

Polymorphism databases

DMDMi150416327.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL050328 Genomic DNA. Translation: CAB89275.2 .
AL669813 Genomic DNA. Translation: CAI17624.2 .
AL645936 Genomic DNA. Translation: CAI18028.2 .
AL929591 Genomic DNA. Translation: CAI41919.2 .
BX927250 Genomic DNA. Translation: CAQ10717.1 .
BX120002 Genomic DNA. Translation: CAI95569.2 .
CR759766 Genomic DNA. Translation: CAQ06621.1 .
CR388408 Genomic DNA. Translation: CAQ08216.1 .
CR936483 Genomic DNA. Translation: CAQ10094.1 . Sequence problems.
BC157878 mRNA. Translation: AAI57879.1 .
CCDSi CCDS43436.2. [Q9NU63-3 ]
RefSeqi NP_001103279.2. NM_001109809.2. [Q9NU63-3 ]
XP_006725548.1. XM_006725485.1. [Q9NU63-3 ]
XP_006725549.1. XM_006725486.1. [Q9NU63-3 ]
UniGenei Hs.156326.

3D structure databases

ProteinModelPortali Q9NU63.
SMRi Q9NU63. Positions 16-56, 90-381.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 131375. 4 interactions.
STRINGi 9606.ENSP00000412932.

PTM databases

PhosphoSitei Q9NU63.

Polymorphism databases

DMDMi 150416327.

Proteomic databases

PaxDbi Q9NU63.
PRIDEi Q9NU63.

Protocols and materials databases

DNASUi 346171.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376881 ; ENSP00000366078 ; ENSG00000204644 . [Q9NU63-1 ]
ENST00000376883 ; ENSP00000366080 ; ENSG00000204644 . [Q9NU63-2 ]
ENST00000383628 ; ENSP00000373124 ; ENSG00000206510 . [Q9NU63-2 ]
ENST00000416974 ; ENSP00000396462 ; ENSG00000223858 . [Q9NU63-2 ]
ENST00000435906 ; ENSP00000412932 ; ENSG00000226858 . [Q9NU63-2 ]
ENST00000437216 ; ENSP00000398086 ; ENSG00000223852 . [Q9NU63-2 ]
ENST00000446005 ; ENSP00000394222 ; ENSG00000234669 . [Q9NU63-2 ]
ENST00000448114 ; ENSP00000409118 ; ENSG00000232099 . [Q9NU63-2 ]
ENST00000488757 ; ENSP00000418259 ; ENSG00000204644 . [Q9NU63-3 ]
ENST00000547542 ; ENSP00000447492 ; ENSG00000223852 . [Q9NU63-1 ]
ENST00000547911 ; ENSP00000449556 ; ENSG00000234669 . [Q9NU63-1 ]
ENST00000548001 ; ENSP00000446541 ; ENSG00000232099 . [Q9NU63-1 ]
ENST00000548337 ; ENSP00000449407 ; ENSG00000232099 . [Q9NU63-3 ]
ENST00000548574 ; ENSP00000446798 ; ENSG00000223852 . [Q9NU63-3 ]
ENST00000548769 ; ENSP00000448351 ; ENSG00000206510 . [Q9NU63-3 ]
ENST00000549167 ; ENSP00000449230 ; ENSG00000226858 . [Q9NU63-3 ]
ENST00000549501 ; ENSP00000447698 ; ENSG00000226858 . [Q9NU63-1 ]
ENST00000552809 ; ENSP00000450279 ; ENSG00000223858 . [Q9NU63-3 ]
ENST00000552898 ; ENSP00000450397 ; ENSG00000223858 . [Q9NU63-1 ]
ENST00000552987 ; ENSP00000448634 ; ENSG00000206510 . [Q9NU63-1 ]
ENST00000553137 ; ENSP00000447495 ; ENSG00000234669 . [Q9NU63-3 ]
GeneIDi 346171.
KEGGi hsa:346171.
UCSCi uc011dlw.2. human. [Q9NU63-3 ]

Organism-specific databases

CTDi 346171.
GeneCardsi GC06M029640.
GC06Mj29636.
GC06Mk29640.
GC06Ml29639.
GC06Mm29640.
GC06Mn29640.
GC06Mo29639.
GeneReviewsi ZFP57.
HGNCi HGNC:18791. ZFP57.
HPAi HPA047172.
MIMi 601410. phenotype.
612192. gene.
neXtProti NX_Q9NU63.
Orphaneti 99886. Transient neonatal diabetes mellitus.
PharmGKBi PA134937821.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG267305.
GeneTreei ENSGT00390000002599.
HOGENOMi HOG000155778.
HOVERGENi HBG108764.
InParanoidi Q9NU63.
KOi K09228.
OMAi LLDVNHA.
OrthoDBi EOG7KM5S9.
PhylomeDBi Q9NU63.
TreeFami TF337947.

Miscellaneous databases

GeneWikii ZFP57.
GenomeRNAii 346171.
NextBioi 98937.
PROi Q9NU63.
SOURCEi Search...

Gene expression databases

Bgeei Q9NU63.
CleanExi HS_ZFP57.
Genevestigatori Q9NU63.

Family and domain databases

Gene3Di 3.30.160.60. 6 hits.
InterProi IPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-284.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  3. Cited for: VARIANTS TNDM1 HIS-166; ASN-193 AND ASP-374, FUNCTION.

Entry informationi

Entry nameiZFP57_HUMAN
AccessioniPrimary (citable) accession number: Q9NU63
Secondary accession number(s): B0S894
, B0V254, B2RXJ7, Q5SSB1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: October 29, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3