Q9NU63 (ZFP57_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 57 homolog Short name=Zfp-57 Alternative name(s): Zinc finger protein 698 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 452 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Ref.3 |
| Subcellular location | Nucleus By similarity. Note: Binds various differentially methylated regions (DMR), including the SNRPN DMR By similarity. |
| Domain | The KRAB domain is required for function as transcriptional repressor By similarity. |
| Involvement in disease | Transient neonatal diabetes mellitus 1 (TNDM1) [MIM:601410]: Neonatal diabetes is a form of diabetes mellitus defined by the onset of mild-to-severe hyperglycemia within the first months of life. In about half of the neonates, diabetes is transient and resolves at a median age of 3 months, whereas the rest have a permanent form of diabetes. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. ZFP57 subfamily. Contains 7 C2H2-type zinc fingers. Contains 1 KRAB domain. |
| Sequence caution | The sequence CAQ10094.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NU63-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NU63-2) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MAAGEPRSLLFFQ → MFEQLKPIEPRDCWREARVKK 78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR | ||||||
| Isoform 3 (identifier: Q9NU63-3) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MAAGEPRSLLFFQ → MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKK 78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 452 | 452 | Zinc finger protein 57 homolog | PRO_0000291964 | |||||
Regions | |||||||||
| Domain | 16 – 88 | 73 | KRAB | ||||||
| Zinc finger | 91 – 113 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 119 – 141 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 147 – 169 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 175 – 197 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 300 – 322 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 328 – 350 | 23 | C2H2-type 6 | ||||||
| Zinc finger | 356 – 378 | 23 | C2H2-type 7; degenerate | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 13 | 13 | MAAGE…LLFFQ → MFEQLKPIEPRDCWREARVK K in isoform 2. | VSP_026329 | |||||
| Alternative sequence | 1 – 13 | 13 | MAAGE…LLFFQ → MFEQLKPIEPVQKTLPWVGE VAATLQEAMKRDCWREARVK K in isoform 3. | VSP_036659 | |||||
| Alternative sequence | 78 | 1 | E → EFVHLPNTEGLSEGKKKELR EQHPSLRDEGTSDDKVFLAC RGAGQCPLSAPAGTMDR in isoform 2 and isoform 3. | VSP_026330 | |||||
| Natural variant | 114 | 1 | N → S. Corresponds to variant rs9461544 [ dbSNP | Ensembl ]. | VAR_032902 | |||||
| Natural variant | 166 | 1 | R → H in TNDM1. Ref.3 | VAR_054771 | |||||
| Natural variant | 193 | 1 | H → N in TNDM1. Ref.3 | VAR_054772 | |||||
| Natural variant | 284 | 1 | D → V. Ref.1 Corresponds to variant rs2535241 [ dbSNP | Ensembl ]. | VAR_032903 | |||||
| Natural variant | 374 | 1 | H → D in TNDM1. Ref.3 | VAR_054773 | |||||
Experimental info | |||||||||
| Sequence conflict | 151 | 1 | L → F in AAI57879. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Entry information
| Entry name | ZFP57_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NU63 Secondary accession number(s): B0S894 Q5SSB1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
