Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NU63

- ZFP57_HUMAN

UniProt

Q9NU63 - ZFP57_HUMAN

Protein

Zinc finger protein 57 homolog

Gene

ZFP57

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 2 (26 Jun 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element By similarity. Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells.By similarity1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei185 – 1851Crucial for 5-methylcytosine recognitionBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri91 – 11323C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri119 – 14123C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri147 – 16923C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri175 – 19723C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri300 – 32223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri328 – 35023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri356 – 37823C2H2-type 7; degeneratePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. DNA methylation involved in embryo development Source: UniProtKB
    2. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    3. peripheral nervous system development Source: Ensembl
    4. regulation of gene expression by genetic imprinting Source: UniProtKB
    5. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 57 homolog
    Short name:
    Zfp-57
    Alternative name(s):
    Zinc finger protein 698
    Gene namesi
    Name:ZFP57
    Synonyms:C6orf40, ZNF698
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:18791. ZFP57.

    Subcellular locationi

    Nucleus By similarity
    Note: Binds various differentially methylated regions (DMR), including the SNRPN DMR.By similarity

    GO - Cellular componenti

    1. nuclear heterochromatin Source: Ensembl

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Transient neonatal diabetes mellitus 1 (TNDM1) [MIM:601410]: Neonatal diabetes is a form of diabetes mellitus defined by the onset of mild-to-severe hyperglycemia within the first months of life. In about half of the neonates, diabetes is transient and resolves at a median age of 3 months, whereas the rest have a permanent form of diabetes.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti166 – 1661R → H in TNDM1. 1 Publication
    VAR_054771
    Natural varianti193 – 1931H → N in TNDM1. 1 Publication
    VAR_054772
    Natural varianti374 – 3741H → D in TNDM1. 1 Publication
    VAR_054773

    Keywords - Diseasei

    Diabetes mellitus, Disease mutation

    Organism-specific databases

    MIMi601410. phenotype.
    Orphaneti99886. Transient neonatal diabetes mellitus.
    PharmGKBiPA134937821.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 452452Zinc finger protein 57 homologPRO_0000291964Add
    BLAST

    Proteomic databases

    PaxDbiQ9NU63.
    PRIDEiQ9NU63.

    PTM databases

    PhosphoSiteiQ9NU63.

    Expressioni

    Gene expression databases

    BgeeiQ9NU63.
    CleanExiHS_ZFP57.
    GenevestigatoriQ9NU63.

    Organism-specific databases

    HPAiHPA047172.

    Interactioni

    Protein-protein interaction databases

    BioGridi131375. 4 interactions.
    STRINGi9606.ENSP00000412932.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NU63.
    SMRiQ9NU63. Positions 16-56, 90-413.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini16 – 8873KRABPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The KRAB domain is required for function as transcriptional repressor.By similarity
    Zinc fingers 3 and 4 mediate recognition of the target element, ZF3 interacting with the 5' half (TGC) and ZF4 interacting with the 3' half (CGC).By similarity

    Sequence similaritiesi

    Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 KRAB domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri91 – 11323C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri119 – 14123C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri147 – 16923C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri175 – 19723C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri300 – 32223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri328 – 35023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri356 – 37823C2H2-type 7; degeneratePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG267305.
    HOGENOMiHOG000155778.
    HOVERGENiHBG108764.
    KOiK09228.
    OMAiLLDVNHA.
    OrthoDBiEOG7KM5S9.
    PhylomeDBiQ9NU63.
    TreeFamiTF337947.

    Family and domain databases

    Gene3Di3.30.160.60. 6 hits.
    InterProiIPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF01352. KRAB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view]
    SMARTiSM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 7 hits.
    [Graphical view]
    SUPFAMiSSF109640. SSF109640. 1 hit.
    PROSITEiPS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 7 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NU63-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAGEPRSLL FFQKPVTFED VAVNFTQEEW DCLDASQRVL YQDVMSETFK    50
    NLTSVARIFL HKPELITKLE QEEEQWRETR VLQASQAGPP FFCYTCGKCF 100
    SRRSYLYSHQ FVHNPKLTNS CSQCGKLFRS PKSLSYHRRM HLGERPFCCT 150
    LCDKTYCDAS GLSRHRRVHL GYRPHSCSVC GKSFRDQSEL KRHQKIHQNQ 200
    EPVDGNQECT LRIPGTQAEF QTPIARSQRS IQGLLDVNHA PVARSQEPIF 250
    RTEGPMAQNQ ASVLKNQAPV TRTQAPITGT LCQDARSNSH PVKPSRLNVF 300
    CCPHCSLTFS KKSYLSRHQK AHLTEPPNYC FHCSKSFSSF SRLVRHQQTH 350
    WKQKSYLCPI CDLSFGEKEG LMDHWRGYKG KDLCQSSHHK CRVILGQWLG 400
    FSHDVPTMAG EEWKHGGDQS PPRIHTPRRR GLREKACKGD KTKEAVSILK 450
    HK 452
    Length:452
    Mass (Da):51,919
    Last modified:June 26, 2007 - v2
    Checksum:i6B285B7FB9ABB3BA
    GO
    Isoform 2 (identifier: Q9NU63-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MAAGEPRSLLFFQ → MFEQLKPIEPRDCWREARVKK
         78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR

    Show »
    Length:516
    Mass (Da):59,176
    Checksum:iC38B9572533B81AE
    GO
    Isoform 3 (identifier: Q9NU63-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MAAGEPRSLLFFQ → MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKK
         78-78: E → EFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDR

    Note: No experimental confirmation available.

    Show »
    Length:536
    Mass (Da):61,358
    Checksum:i0DB8D7F9FCCF4D67
    GO

    Sequence cautioni

    The sequence CAQ10094.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti151 – 1511L → F in AAI57879. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti114 – 1141N → S.
    Corresponds to variant rs9461544 [ dbSNP | Ensembl ].
    VAR_032902
    Natural varianti166 – 1661R → H in TNDM1. 1 Publication
    VAR_054771
    Natural varianti193 – 1931H → N in TNDM1. 1 Publication
    VAR_054772
    Natural varianti284 – 2841D → V.1 Publication
    Corresponds to variant rs2535241 [ dbSNP | Ensembl ].
    VAR_032903
    Natural varianti374 – 3741H → D in TNDM1. 1 Publication
    VAR_054773

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1313MAAGE…LLFFQ → MFEQLKPIEPRDCWREARVK K in isoform 2. CuratedVSP_026329Add
    BLAST
    Alternative sequencei1 – 1313MAAGE…LLFFQ → MFEQLKPIEPVQKTLPWVGE VAATLQEAMKRDCWREARVK K in isoform 3. 1 PublicationVSP_036659Add
    BLAST
    Alternative sequencei78 – 781E → EFVHLPNTEGLSEGKKKELR EQHPSLRDEGTSDDKVFLAC RGAGQCPLSAPAGTMDR in isoform 2 and isoform 3. 1 PublicationVSP_026330

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL050328 Genomic DNA. Translation: CAB89275.2.
    AL669813 Genomic DNA. Translation: CAI17624.2.
    AL645936 Genomic DNA. Translation: CAI18028.2.
    AL929591 Genomic DNA. Translation: CAI41919.2.
    BX927250 Genomic DNA. Translation: CAQ10717.1.
    BX120002 Genomic DNA. Translation: CAI95569.2.
    CR759766 Genomic DNA. Translation: CAQ06621.1.
    CR388408 Genomic DNA. Translation: CAQ08216.1.
    CR936483 Genomic DNA. Translation: CAQ10094.1. Sequence problems.
    BC157878 mRNA. Translation: AAI57879.1.
    CCDSiCCDS43436.2. [Q9NU63-3]
    RefSeqiNP_001103279.2. NM_001109809.2. [Q9NU63-3]
    XP_006725548.1. XM_006725485.1. [Q9NU63-3]
    XP_006725549.1. XM_006725486.1. [Q9NU63-3]
    UniGeneiHs.156326.

    Genome annotation databases

    EnsembliENST00000376881; ENSP00000366078; ENSG00000204644. [Q9NU63-2]
    ENST00000376883; ENSP00000366080; ENSG00000204644. [Q9NU63-2]
    ENST00000383628; ENSP00000373124; ENSG00000206510. [Q9NU63-2]
    ENST00000416974; ENSP00000396462; ENSG00000223858. [Q9NU63-2]
    ENST00000435906; ENSP00000412932; ENSG00000226858. [Q9NU63-2]
    ENST00000437216; ENSP00000398086; ENSG00000223852. [Q9NU63-2]
    ENST00000446005; ENSP00000394222; ENSG00000234669. [Q9NU63-2]
    ENST00000448114; ENSP00000409118; ENSG00000232099. [Q9NU63-2]
    ENST00000488757; ENSP00000418259; ENSG00000204644. [Q9NU63-3]
    ENST00000547542; ENSP00000447492; ENSG00000223852. [Q9NU63-2]
    ENST00000548001; ENSP00000446541; ENSG00000232099. [Q9NU63-2]
    ENST00000548337; ENSP00000449407; ENSG00000232099. [Q9NU63-3]
    ENST00000548574; ENSP00000446798; ENSG00000223852. [Q9NU63-3]
    ENST00000548769; ENSP00000448351; ENSG00000206510. [Q9NU63-3]
    ENST00000549167; ENSP00000449230; ENSG00000226858. [Q9NU63-3]
    ENST00000549501; ENSP00000447698; ENSG00000226858. [Q9NU63-2]
    ENST00000552809; ENSP00000450279; ENSG00000223858. [Q9NU63-3]
    ENST00000552898; ENSP00000450397; ENSG00000223858. [Q9NU63-2]
    ENST00000552987; ENSP00000448634; ENSG00000206510. [Q9NU63-2]
    ENST00000553137; ENSP00000447495; ENSG00000234669. [Q9NU63-3]
    GeneIDi346171.
    KEGGihsa:346171.
    UCSCiuc011dlw.2. human. [Q9NU63-3]

    Polymorphism databases

    DMDMi150416327.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL050328 Genomic DNA. Translation: CAB89275.2 .
    AL669813 Genomic DNA. Translation: CAI17624.2 .
    AL645936 Genomic DNA. Translation: CAI18028.2 .
    AL929591 Genomic DNA. Translation: CAI41919.2 .
    BX927250 Genomic DNA. Translation: CAQ10717.1 .
    BX120002 Genomic DNA. Translation: CAI95569.2 .
    CR759766 Genomic DNA. Translation: CAQ06621.1 .
    CR388408 Genomic DNA. Translation: CAQ08216.1 .
    CR936483 Genomic DNA. Translation: CAQ10094.1 . Sequence problems.
    BC157878 mRNA. Translation: AAI57879.1 .
    CCDSi CCDS43436.2. [Q9NU63-3 ]
    RefSeqi NP_001103279.2. NM_001109809.2. [Q9NU63-3 ]
    XP_006725548.1. XM_006725485.1. [Q9NU63-3 ]
    XP_006725549.1. XM_006725486.1. [Q9NU63-3 ]
    UniGenei Hs.156326.

    3D structure databases

    ProteinModelPortali Q9NU63.
    SMRi Q9NU63. Positions 16-56, 90-413.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 131375. 4 interactions.
    STRINGi 9606.ENSP00000412932.

    PTM databases

    PhosphoSitei Q9NU63.

    Polymorphism databases

    DMDMi 150416327.

    Proteomic databases

    PaxDbi Q9NU63.
    PRIDEi Q9NU63.

    Protocols and materials databases

    DNASUi 346171.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000376881 ; ENSP00000366078 ; ENSG00000204644 . [Q9NU63-2 ]
    ENST00000376883 ; ENSP00000366080 ; ENSG00000204644 . [Q9NU63-2 ]
    ENST00000383628 ; ENSP00000373124 ; ENSG00000206510 . [Q9NU63-2 ]
    ENST00000416974 ; ENSP00000396462 ; ENSG00000223858 . [Q9NU63-2 ]
    ENST00000435906 ; ENSP00000412932 ; ENSG00000226858 . [Q9NU63-2 ]
    ENST00000437216 ; ENSP00000398086 ; ENSG00000223852 . [Q9NU63-2 ]
    ENST00000446005 ; ENSP00000394222 ; ENSG00000234669 . [Q9NU63-2 ]
    ENST00000448114 ; ENSP00000409118 ; ENSG00000232099 . [Q9NU63-2 ]
    ENST00000488757 ; ENSP00000418259 ; ENSG00000204644 . [Q9NU63-3 ]
    ENST00000547542 ; ENSP00000447492 ; ENSG00000223852 . [Q9NU63-2 ]
    ENST00000548001 ; ENSP00000446541 ; ENSG00000232099 . [Q9NU63-2 ]
    ENST00000548337 ; ENSP00000449407 ; ENSG00000232099 . [Q9NU63-3 ]
    ENST00000548574 ; ENSP00000446798 ; ENSG00000223852 . [Q9NU63-3 ]
    ENST00000548769 ; ENSP00000448351 ; ENSG00000206510 . [Q9NU63-3 ]
    ENST00000549167 ; ENSP00000449230 ; ENSG00000226858 . [Q9NU63-3 ]
    ENST00000549501 ; ENSP00000447698 ; ENSG00000226858 . [Q9NU63-2 ]
    ENST00000552809 ; ENSP00000450279 ; ENSG00000223858 . [Q9NU63-3 ]
    ENST00000552898 ; ENSP00000450397 ; ENSG00000223858 . [Q9NU63-2 ]
    ENST00000552987 ; ENSP00000448634 ; ENSG00000206510 . [Q9NU63-2 ]
    ENST00000553137 ; ENSP00000447495 ; ENSG00000234669 . [Q9NU63-3 ]
    GeneIDi 346171.
    KEGGi hsa:346171.
    UCSCi uc011dlw.2. human. [Q9NU63-3 ]

    Organism-specific databases

    CTDi 346171.
    GeneCardsi GC06M029640.
    GC06Mj29636.
    GC06Mk29640.
    GC06Ml29639.
    GC06Mm29640.
    GC06Mn29640.
    GC06Mo29639.
    GeneReviewsi ZFP57.
    HGNCi HGNC:18791. ZFP57.
    HPAi HPA047172.
    MIMi 601410. phenotype.
    612192. gene.
    neXtProti NX_Q9NU63.
    Orphaneti 99886. Transient neonatal diabetes mellitus.
    PharmGKBi PA134937821.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG267305.
    HOGENOMi HOG000155778.
    HOVERGENi HBG108764.
    KOi K09228.
    OMAi LLDVNHA.
    OrthoDBi EOG7KM5S9.
    PhylomeDBi Q9NU63.
    TreeFami TF337947.

    Miscellaneous databases

    GeneWikii ZFP57.
    GenomeRNAii 346171.
    NextBioi 98937.
    PROi Q9NU63.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9NU63.
    CleanExi HS_ZFP57.
    Genevestigatori Q9NU63.

    Family and domain databases

    Gene3Di 3.30.160.60. 6 hits.
    InterProi IPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF01352. KRAB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view ]
    SMARTi SM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 7 hits.
    [Graphical view ]
    SUPFAMi SSF109640. SSF109640. 1 hit.
    PROSITEi PS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 7 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-284.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    3. Cited for: VARIANTS TNDM1 HIS-166; ASN-193 AND ASP-374, FUNCTION.

    Entry informationi

    Entry nameiZFP57_HUMAN
    AccessioniPrimary (citable) accession number: Q9NU63
    Secondary accession number(s): B0S894
    , B0V254, B2RXJ7, Q5SSB1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 26, 2007
    Last sequence update: June 26, 2007
    Last modified: October 1, 2014
    This is version 107 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3