Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NTW7

- ZF64B_HUMAN

UniProt

Q9NTW7 - ZF64B_HUMAN

Protein

Zinc finger protein 64 homolog, isoforms 3 and 4

Gene

ZFP64

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 3 (30 Apr 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi497 – 4971Zinc 1By similarity
    Metal bindingi500 – 5001Zinc 1By similarity
    Metal bindingi513 – 5131Zinc 1By similarity
    Metal bindingi517 – 5171Zinc 1By similarity
    Metal bindingi525 – 5251Zinc 2By similarity
    Metal bindingi528 – 5281Zinc 2By similarity
    Metal bindingi541 – 5411Zinc 2By similarity
    Metal bindingi546 – 5461Zinc 2By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri175 – 19723C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri203 – 22523C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri231 – 25323C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri299 – 32426C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri330 – 35223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri358 – 38023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri386 – 40823C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri414 – 43623C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri442 – 46524C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri467 – 48923C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri495 – 51723C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri523 – 54624C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri580 – 60223C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 64 homolog, isoforms 3 and 4
    Short name:
    Zfp-64
    Alternative name(s):
    Zinc finger protein 338
    Gene namesi
    Name:ZFP64
    Synonyms:ZNF338
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:15940. ZFP64.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38060.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 645645Zinc finger protein 64 homolog, isoforms 3 and 4PRO_0000047308Add
    BLAST

    Proteomic databases

    MaxQBiQ9NTW7.
    PRIDEiQ9NTW7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NTW7.
    BgeeiQ9NTW7.
    CleanExiHS_ZFP64.
    GenevestigatoriQ9NTW7.

    Interactioni

    Protein-protein interaction databases

    BioGridi120853. 14 interactions.
    IntActiQ9NTW7. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NTW7.
    SMRiQ9NTW7. Positions 146-603.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 13 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri175 – 19723C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri203 – 22523C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri231 – 25323C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri299 – 32426C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri330 – 35223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri358 – 38023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri386 – 40823C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri414 – 43623C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri442 – 46524C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri467 – 48923C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri495 – 51723C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri523 – 54624C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri580 – 60223C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    HOVERGENiHBG056373.
    OMAiHMAKIVT.

    Family and domain databases

    Gene3Di3.30.160.60. 12 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 15 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 13 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: Q9NTW7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNASSEGESF AGSVQIPGGT TVLVELTPDI HICGICKQQF NNLDAFVAHK    50
    QSGCQLTGTS AAAPSTVQFV SEETVPATQT QTTTRTITSE TQTITVSAPE 100
    FVFEHGYQTY LPTESNENQT ATVISLPAKS RTKKPTTPPA QKRLNCCYPG 150
    CQFKTAYGMK DMERHLKIHT GDKPHKCEVC GKCFSRKDKL KTHMRCHTGV 200
    KPYKCKTCDY AAADSSSLNK HLRIHSDERP FKCQICPYAS RNSSQLTVHL 250
    RSHTASELDD DVPKANCLST ESTDTPKAPV ITLPSEAREQ MATLGERTFN 300
    CCYPGCHFKT VHGMKDLDRH LRIHTGDKPH KCEFCDKCFS RKDNLTMHMR 350
    CHTSVKPHKC HLCDYAAVDS SSLKKHLRIH SDERPYKCQL CPYASRNSSQ 400
    LTVHLRSHTG DTPFQCWLCS AKFKISSDLK RHMIVHSGEK PFKCEFCDVR 450
    CTMKANLKSH IRIKHTFKCL HCAFQGRDRA DLLEHSRLHQ ADHPEKCPEC 500
    SYSCSSAAAL RVHSRVHCKD RPFKCDFCSF DTKRPSSLAK HVDKVHRDEA 550
    KTENRAPLGK EGLREGSSQH VAKIVTQRAF RCETCGASFV RDDSLRCHKK 600
    QHSDQSENKN SDLVTFPPES GASGQLSTLV SVGQLEAPLE PSQDL 645
    Length:645
    Mass (Da):72,217
    Last modified:April 30, 2003 - v3
    Checksum:iD7D336A59C128CC0
    GO
    Isoform 4 (identifier: Q9NTW7-2) [UniParc]FASTAAdd to Basket

    Also known as: ZNF338

    The sequence of this isoform differs from the canonical sequence as follows:
         1-219: Missing.
         220-254: KHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHT → MSRRKQAKPQHLNSEEPRPARRECAEVAPQVAGEP

    Show »
    Length:426
    Mass (Da):48,165
    Checksum:i1058B24E5147E9C7
    GO
    Isoform 1 (identifier: Q9NPA5-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9NPA5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:681
    Mass (Da):74,644
    GO
    Isoform 2 (identifier: Q9NPA5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9NPA5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:627
    Mass (Da):68,621
    GO
    Isoform 5 (identifier: Q9NTW7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         411-415: DTPFQ → CCYVA
         416-645: Missing.

    Show »
    Length:415
    Mass (Da):46,253
    Checksum:iFF37B0E6DE035CF7
    GO
    Isoform 6 (identifier: Q9NTW7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         16-18: IPG → S
         236-390: Missing.
         412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD

    Note: Gene prediction based on EST data.

    Show »
    Length:679
    Mass (Da):74,463
    Checksum:iED2C59DD4F6BEC4D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti240 – 2401S → G in BAD96432. 1 PublicationCurated
    Sequence conflicti521 – 5211R → C in AAP88762. 1 PublicationCurated
    Sequence conflicti521 – 5211R → C in BC021087. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti593 – 5931D → E in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035564
    Natural varianti609 – 6091K → N in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035565

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 219219Missing in isoform 4. 1 PublicationVSP_007285Add
    BLAST
    Alternative sequencei16 – 183IPG → S in isoform 6. CuratedVSP_046896
    Alternative sequencei220 – 25435KHLRI…LRSHT → MSRRKQAKPQHLNSEEPRPA RRECAEVAPQVAGEP in isoform 4. 1 PublicationVSP_007286Add
    BLAST
    Alternative sequencei236 – 390155Missing in isoform 6. CuratedVSP_046897Add
    BLAST
    Alternative sequencei411 – 4155DTPFQ → CCYVA in isoform 5. 1 PublicationVSP_038213
    Alternative sequencei412 – 645234TPFQC…PSQDL → APFQCWLCSAKFKISSDLKR HMRVHSGEKPFKCEFCNVRC TMKGNLKSHIRIKHSGNNFK CPHCDFLGDSKATLRKHSRV HQSEHPEKCSECSYSCSSKA ALRIHERIHCTDRPFKCNYC SFDTKQPSNLSKHMKKFHGD MVKTEALERKDTGRQSSRQV AKLDAKKSFHCDICDASFMR EDSLRSHKRQHSEYSESKNS DVTVLQFQIDPSKQPATPLT VGHLQVPLQPSQVPQFSEGR VKIIVGHQVPQANTIVQAAA AAVNIVPPALVAQNPEELPG NSRLQILRQVSLIAPPQSSR CPSEAGAMTQPAVLLTTHEQ TDGATLHQTLIPTASGGPQE GSGNQTFITSSGITCTDFEG LNALIQEGTAEVTVVSDGGQ NIAVATTAPPVFSSSSQQEL PKQTYSIIQGAAHPALLCPA DSIPD in isoform 6. CuratedVSP_046898Add
    BLAST
    Alternative sequencei416 – 645230Missing in isoform 5. 1 PublicationVSP_038214Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022690 mRNA. Translation: BAB14182.1.
    BT009760 mRNA. Translation: AAP88762.1.
    AK222712 mRNA. Translation: BAD96432.1. Different termination.
    AL109984 Genomic DNA. Translation: CAB86405.2.
    AL109984, AL121771 Genomic DNA. Translation: CAI43095.1.
    AL109984, AL121771 Genomic DNA. Translation: CAM28323.1.
    AL121771, AL109984 Genomic DNA. Translation: CAI21789.1.
    AL121771, AL109984 Genomic DNA. Translation: CAM28264.1.
    AL121923 Genomic DNA. No translation available.
    CH471077 Genomic DNA. Translation: EAW75591.1.
    BC021087 mRNA. No translation available.
    CCDSiCCDS13439.1. [Q9NTW7-1]
    CCDS13442.1. [Q9NTW7-4]
    RefSeqiNP_955459.2. NM_199427.2. [Q9NTW7-1]
    XP_005260507.1. XM_005260450.1. [Q9NTW7-2]
    UniGeneiHs.473082.

    Genome annotation databases

    EnsembliENST00000361387; ENSP00000355179; ENSG00000020256. [Q9NTW7-1]
    ENST00000371515; ENSP00000360570; ENSG00000020256. [Q9NTW7-4]
    ENST00000371518; ENSP00000360573; ENSG00000020256. [Q9NTW7-3]
    ENST00000371523; ENSP00000360578; ENSG00000020256. [Q9NTW7-2]
    GeneIDi55734.
    KEGGihsa:55734.
    UCSCiuc002xwj.3. human. [Q9NTW7-2]
    uc002xwk.3. human. [Q9NTW7-1]

    Polymorphism databases

    DMDMi30316391.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022690 mRNA. Translation: BAB14182.1 .
    BT009760 mRNA. Translation: AAP88762.1 .
    AK222712 mRNA. Translation: BAD96432.1 . Different termination.
    AL109984 Genomic DNA. Translation: CAB86405.2 .
    AL109984 , AL121771 Genomic DNA. Translation: CAI43095.1 .
    AL109984 , AL121771 Genomic DNA. Translation: CAM28323.1 .
    AL121771 , AL109984 Genomic DNA. Translation: CAI21789.1 .
    AL121771 , AL109984 Genomic DNA. Translation: CAM28264.1 .
    AL121923 Genomic DNA. No translation available.
    CH471077 Genomic DNA. Translation: EAW75591.1 .
    BC021087 mRNA. No translation available.
    CCDSi CCDS13439.1. [Q9NTW7-1 ]
    CCDS13442.1. [Q9NTW7-4 ]
    RefSeqi NP_955459.2. NM_199427.2. [Q9NTW7-1 ]
    XP_005260507.1. XM_005260450.1. [Q9NTW7-2 ]
    UniGenei Hs.473082.

    3D structure databases

    ProteinModelPortali Q9NTW7.
    SMRi Q9NTW7. Positions 146-603.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120853. 14 interactions.
    IntActi Q9NTW7. 2 interactions.

    Polymorphism databases

    DMDMi 30316391.

    Proteomic databases

    MaxQBi Q9NTW7.
    PRIDEi Q9NTW7.

    Protocols and materials databases

    DNASUi 55734.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361387 ; ENSP00000355179 ; ENSG00000020256 . [Q9NTW7-1 ]
    ENST00000371515 ; ENSP00000360570 ; ENSG00000020256 . [Q9NTW7-4 ]
    ENST00000371518 ; ENSP00000360573 ; ENSG00000020256 . [Q9NTW7-3 ]
    ENST00000371523 ; ENSP00000360578 ; ENSG00000020256 . [Q9NTW7-2 ]
    GeneIDi 55734.
    KEGGi hsa:55734.
    UCSCi uc002xwj.3. human. [Q9NTW7-2 ]
    uc002xwk.3. human. [Q9NTW7-1 ]

    Organism-specific databases

    CTDi 55734.
    GeneCardsi GC20M050668.
    HGNCi HGNC:15940. ZFP64.
    neXtProti NX_Q9NTW7.
    PharmGKBi PA38060.
    GenAtlasi Search...

    Phylogenomic databases

    HOVERGENi HBG056373.
    OMAi HMAKIVT.

    Miscellaneous databases

    GenomeRNAii 55734.
    NextBioi 60666.

    Gene expression databases

    ArrayExpressi Q9NTW7.
    Bgeei Q9NTW7.
    CleanExi HS_ZFP64.
    Genevestigatori Q9NTW7.

    Family and domain databases

    Gene3Di 3.30.160.60. 12 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 15 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 13 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Teratocarcinoma.
    2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Colon.
    4. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Lymph.
    7. Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLU-593 AND ASN-609.

    Entry informationi

    Entry nameiZF64B_HUMAN
    AccessioniPrimary (citable) accession number: Q9NTW7
    Secondary accession number(s): A2A2N4
    , Q53H69, Q53XQ1, Q5JWM0, Q5JWM1, Q8WU98, Q9H9P1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 27, 2002
    Last sequence update: April 30, 2003
    Last modified: October 1, 2014
    This is version 129 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3