Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NTW7

- ZF64B_HUMAN

UniProt

Q9NTW7 - ZF64B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 64 homolog, isoforms 3 and 4

Gene

ZFP64

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi497 – 4971Zinc 1By similarity
Metal bindingi500 – 5001Zinc 1By similarity
Metal bindingi513 – 5131Zinc 1By similarity
Metal bindingi517 – 5171Zinc 1By similarity
Metal bindingi525 – 5251Zinc 2By similarity
Metal bindingi528 – 5281Zinc 2By similarity
Metal bindingi541 – 5411Zinc 2By similarity
Metal bindingi546 – 5461Zinc 2By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri175 – 19723C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri203 – 22523C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri231 – 25323C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri299 – 32426C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri330 – 35223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri386 – 40823C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri414 – 43623C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri442 – 46524C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri467 – 48923C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri495 – 51723C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri523 – 54624C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri580 – 60223C2H2-type 13PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 64 homolog, isoforms 3 and 4
Short name:
Zfp-64
Alternative name(s):
Zinc finger protein 338
Gene namesi
Name:ZFP64
Synonyms:ZNF338
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:15940. ZFP64.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38060.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 645645Zinc finger protein 64 homolog, isoforms 3 and 4PRO_0000047308Add
BLAST

Proteomic databases

MaxQBiQ9NTW7.
PRIDEiQ9NTW7.

Expressioni

Gene expression databases

BgeeiQ9NTW7.
CleanExiHS_ZFP64.
ExpressionAtlasiQ9NTW7. baseline and differential.
GenevestigatoriQ9NTW7.

Interactioni

Protein-protein interaction databases

BioGridi120853. 14 interactions.
IntActiQ9NTW7. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9NTW7.
SMRiQ9NTW7. Positions 146-603.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 13 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri175 – 19723C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri203 – 22523C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri231 – 25323C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri299 – 32426C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri330 – 35223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri386 – 40823C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri414 – 43623C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri442 – 46524C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri467 – 48923C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri495 – 51723C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri523 – 54624C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri580 – 60223C2H2-type 13PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00530000063079.
HOVERGENiHBG056373.
OMAiHMAKIVT.

Family and domain databases

Gene3Di3.30.160.60. 12 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: Q9NTW7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNASSEGESF AGSVQIPGGT TVLVELTPDI HICGICKQQF NNLDAFVAHK
60 70 80 90 100
QSGCQLTGTS AAAPSTVQFV SEETVPATQT QTTTRTITSE TQTITVSAPE
110 120 130 140 150
FVFEHGYQTY LPTESNENQT ATVISLPAKS RTKKPTTPPA QKRLNCCYPG
160 170 180 190 200
CQFKTAYGMK DMERHLKIHT GDKPHKCEVC GKCFSRKDKL KTHMRCHTGV
210 220 230 240 250
KPYKCKTCDY AAADSSSLNK HLRIHSDERP FKCQICPYAS RNSSQLTVHL
260 270 280 290 300
RSHTASELDD DVPKANCLST ESTDTPKAPV ITLPSEAREQ MATLGERTFN
310 320 330 340 350
CCYPGCHFKT VHGMKDLDRH LRIHTGDKPH KCEFCDKCFS RKDNLTMHMR
360 370 380 390 400
CHTSVKPHKC HLCDYAAVDS SSLKKHLRIH SDERPYKCQL CPYASRNSSQ
410 420 430 440 450
LTVHLRSHTG DTPFQCWLCS AKFKISSDLK RHMIVHSGEK PFKCEFCDVR
460 470 480 490 500
CTMKANLKSH IRIKHTFKCL HCAFQGRDRA DLLEHSRLHQ ADHPEKCPEC
510 520 530 540 550
SYSCSSAAAL RVHSRVHCKD RPFKCDFCSF DTKRPSSLAK HVDKVHRDEA
560 570 580 590 600
KTENRAPLGK EGLREGSSQH VAKIVTQRAF RCETCGASFV RDDSLRCHKK
610 620 630 640
QHSDQSENKN SDLVTFPPES GASGQLSTLV SVGQLEAPLE PSQDL
Length:645
Mass (Da):72,217
Last modified:April 30, 2003 - v3
Checksum:iD7D336A59C128CC0
GO
Isoform 4 (identifier: Q9NTW7-2) [UniParc]FASTAAdd to Basket

Also known as: ZNF338

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-254: KHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHT → MSRRKQAKPQHLNSEEPRPARRECAEVAPQVAGEP

Show »
Length:426
Mass (Da):48,165
Checksum:i1058B24E5147E9C7
GO
Isoform 1 (identifier: Q9NPA5-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9NPA5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:681
Mass (Da):74,644
GO
Isoform 2 (identifier: Q9NPA5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9NPA5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:627
Mass (Da):68,621
GO
Isoform 5 (identifier: Q9NTW7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-415: DTPFQ → CCYVA
     416-645: Missing.

Show »
Length:415
Mass (Da):46,253
Checksum:iFF37B0E6DE035CF7
GO
Isoform 6 (identifier: Q9NTW7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-18: IPG → S
     236-390: Missing.
     412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD

Note: Gene prediction based on EST data.

Show »
Length:679
Mass (Da):74,463
Checksum:iED2C59DD4F6BEC4D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti240 – 2401S → G in BAD96432. 1 PublicationCurated
Sequence conflicti521 – 5211R → C in AAP88762. 1 PublicationCurated
Sequence conflicti521 – 5211R → C in BC021087. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti593 – 5931D → E in a breast cancer sample; somatic mutation. 1 Publication
VAR_035564
Natural varianti609 – 6091K → N in a breast cancer sample; somatic mutation. 1 Publication
VAR_035565

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 219219Missing in isoform 4. 1 PublicationVSP_007285Add
BLAST
Alternative sequencei16 – 183IPG → S in isoform 6. CuratedVSP_046896
Alternative sequencei220 – 25435KHLRI…LRSHT → MSRRKQAKPQHLNSEEPRPA RRECAEVAPQVAGEP in isoform 4. 1 PublicationVSP_007286Add
BLAST
Alternative sequencei236 – 390155Missing in isoform 6. CuratedVSP_046897Add
BLAST
Alternative sequencei411 – 4155DTPFQ → CCYVA in isoform 5. 1 PublicationVSP_038213
Alternative sequencei412 – 645234TPFQC…PSQDL → APFQCWLCSAKFKISSDLKR HMRVHSGEKPFKCEFCNVRC TMKGNLKSHIRIKHSGNNFK CPHCDFLGDSKATLRKHSRV HQSEHPEKCSECSYSCSSKA ALRIHERIHCTDRPFKCNYC SFDTKQPSNLSKHMKKFHGD MVKTEALERKDTGRQSSRQV AKLDAKKSFHCDICDASFMR EDSLRSHKRQHSEYSESKNS DVTVLQFQIDPSKQPATPLT VGHLQVPLQPSQVPQFSEGR VKIIVGHQVPQANTIVQAAA AAVNIVPPALVAQNPEELPG NSRLQILRQVSLIAPPQSSR CPSEAGAMTQPAVLLTTHEQ TDGATLHQTLIPTASGGPQE GSGNQTFITSSGITCTDFEG LNALIQEGTAEVTVVSDGGQ NIAVATTAPPVFSSSSQQEL PKQTYSIIQGAAHPALLCPA DSIPD in isoform 6. CuratedVSP_046898Add
BLAST
Alternative sequencei416 – 645230Missing in isoform 5. 1 PublicationVSP_038214Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022690 mRNA. Translation: BAB14182.1.
BT009760 mRNA. Translation: AAP88762.1.
AK222712 mRNA. Translation: BAD96432.1. Different termination.
AL109984 Genomic DNA. Translation: CAB86405.2.
AL109984, AL121771 Genomic DNA. Translation: CAI43095.1.
AL109984, AL121771 Genomic DNA. Translation: CAM28323.1.
AL121771, AL109984 Genomic DNA. Translation: CAI21789.1.
AL121771, AL109984 Genomic DNA. Translation: CAM28264.1.
AL121923 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW75591.1.
BC021087 mRNA. No translation available.
CCDSiCCDS13439.1. [Q9NTW7-1]
CCDS13442.1. [Q9NTW7-4]
RefSeqiNP_955459.2. NM_199427.2. [Q9NTW7-1]
XP_005260507.1. XM_005260450.1. [Q9NTW7-2]
UniGeneiHs.473082.

Genome annotation databases

EnsembliENST00000361387; ENSP00000355179; ENSG00000020256. [Q9NTW7-1]
ENST00000371515; ENSP00000360570; ENSG00000020256. [Q9NTW7-4]
ENST00000371518; ENSP00000360573; ENSG00000020256. [Q9NTW7-3]
ENST00000371523; ENSP00000360578; ENSG00000020256. [Q9NTW7-2]
GeneIDi55734.
KEGGihsa:55734.
UCSCiuc002xwj.3. human. [Q9NTW7-2]
uc002xwk.3. human. [Q9NTW7-1]

Polymorphism databases

DMDMi30316391.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022690 mRNA. Translation: BAB14182.1 .
BT009760 mRNA. Translation: AAP88762.1 .
AK222712 mRNA. Translation: BAD96432.1 . Different termination.
AL109984 Genomic DNA. Translation: CAB86405.2 .
AL109984 , AL121771 Genomic DNA. Translation: CAI43095.1 .
AL109984 , AL121771 Genomic DNA. Translation: CAM28323.1 .
AL121771 , AL109984 Genomic DNA. Translation: CAI21789.1 .
AL121771 , AL109984 Genomic DNA. Translation: CAM28264.1 .
AL121923 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW75591.1 .
BC021087 mRNA. No translation available.
CCDSi CCDS13439.1. [Q9NTW7-1 ]
CCDS13442.1. [Q9NTW7-4 ]
RefSeqi NP_955459.2. NM_199427.2. [Q9NTW7-1 ]
XP_005260507.1. XM_005260450.1. [Q9NTW7-2 ]
UniGenei Hs.473082.

3D structure databases

ProteinModelPortali Q9NTW7.
SMRi Q9NTW7. Positions 146-603.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120853. 14 interactions.
IntActi Q9NTW7. 2 interactions.

Polymorphism databases

DMDMi 30316391.

Proteomic databases

MaxQBi Q9NTW7.
PRIDEi Q9NTW7.

Protocols and materials databases

DNASUi 55734.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361387 ; ENSP00000355179 ; ENSG00000020256 . [Q9NTW7-1 ]
ENST00000371515 ; ENSP00000360570 ; ENSG00000020256 . [Q9NTW7-4 ]
ENST00000371518 ; ENSP00000360573 ; ENSG00000020256 . [Q9NTW7-3 ]
ENST00000371523 ; ENSP00000360578 ; ENSG00000020256 . [Q9NTW7-2 ]
GeneIDi 55734.
KEGGi hsa:55734.
UCSCi uc002xwj.3. human. [Q9NTW7-2 ]
uc002xwk.3. human. [Q9NTW7-1 ]

Organism-specific databases

CTDi 55734.
GeneCardsi GC20M050668.
HGNCi HGNC:15940. ZFP64.
neXtProti NX_Q9NTW7.
PharmGKBi PA38060.
GenAtlasi Search...

Phylogenomic databases

GeneTreei ENSGT00530000063079.
HOVERGENi HBG056373.
OMAi HMAKIVT.

Miscellaneous databases

GenomeRNAii 55734.
NextBioi 60666.

Gene expression databases

Bgeei Q9NTW7.
CleanExi HS_ZFP64.
ExpressionAtlasi Q9NTW7. baseline and differential.
Genevestigatori Q9NTW7.

Family and domain databases

Gene3Di 3.30.160.60. 12 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 15 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Teratocarcinoma.
  2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Colon.
  4. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Lymph.
  7. Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLU-593 AND ASN-609.

Entry informationi

Entry nameiZF64B_HUMAN
AccessioniPrimary (citable) accession number: Q9NTW7
Secondary accession number(s): A2A2N4
, Q53H69, Q53XQ1, Q5JWM0, Q5JWM1, Q8WU98, Q9H9P1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: April 30, 2003
Last modified: October 29, 2014
This is version 130 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3