Q9NTW7 (ZF64B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 64 homolog, isoforms 3 and 4 Short name=Zfp-64 Alternative name(s): Zinc finger protein 338 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 645 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 13 C2H2-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: Q9NTW7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 4 (identifier: Q9NTW7-2) Also known as: ZNF338; The sequence of this isoform differs from the canonical sequence as follows: 1-219: Missing. 220-254: KHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHT → MSRRKQAKPQHLNSEEPRPARRECAEVAPQVAGEP | ||||||
| Isoform 1 (identifier: Q9NPA5-1) The sequence of this isoform can be found in the external entry Q9NPA5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 2 (identifier: Q9NPA5-2) The sequence of this isoform can be found in the external entry Q9NPA5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 5 (identifier: Q9NTW7-3) The sequence of this isoform differs from the canonical sequence as follows: 411-415: DTPFQ → CCYVA 416-645: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 645 | 645 | Zinc finger protein 64 homolog, isoforms 3 and 4 | PRO_0000047308 | |||||
Regions | |||||||||
| Zinc finger | 175 – 197 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 203 – 225 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 231 – 253 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 299 – 324 | 26 | C2H2-type 4; atypical | ||||||
| Zinc finger | 330 – 352 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 358 – 380 | 23 | C2H2-type 6 | ||||||
| Zinc finger | 386 – 408 | 23 | C2H2-type 7 | ||||||
| Zinc finger | 414 – 436 | 23 | C2H2-type 8 | ||||||
| Zinc finger | 442 – 465 | 24 | C2H2-type 9 | ||||||
| Zinc finger | 467 – 489 | 23 | C2H2-type 10 | ||||||
| Zinc finger | 495 – 517 | 23 | C2H2-type 11 | ||||||
| Zinc finger | 523 – 546 | 24 | C2H2-type 12 | ||||||
| Zinc finger | 580 – 602 | 23 | C2H2-type 13 | ||||||
Sites | |||||||||
| Metal binding | 497 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 500 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 513 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 517 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 525 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 528 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 541 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 546 | 1 | Zinc 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 219 | 219 | Missing in isoform 4. | VSP_007285 | |||||
| Alternative sequence | 220 – 254 | 35 | KHLRI…LRSHT → MSRRKQAKPQHLNSEEPRPA RRECAEVAPQVAGEP in isoform 4. | VSP_007286 | |||||
| Alternative sequence | 411 – 415 | 5 | DTPFQ → CCYVA in isoform 5. | VSP_038213 | |||||
| Alternative sequence | 416 – 645 | 230 | Missing in isoform 5. | VSP_038214 | |||||
| Natural variant | 593 | 1 | D → E in a breast cancer sample; somatic mutation. Ref.7 | VAR_035564 | |||||
| Natural variant | 609 | 1 | K → N in a breast cancer sample; somatic mutation. Ref.7 | VAR_035565 | |||||
Experimental info | |||||||||
| Sequence conflict | 240 | 1 | S → G in BAD96432. Ref.3 | ||||||
| Sequence conflict | 521 | 1 | R → C in AAP88762. Ref.2 | ||||||
| Sequence conflict | 521 | 1 | R → C in BC021087. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022690 mRNA. Translation: BAB14182.1. BT009760 mRNA. Translation: AAP88762.1. AK222712 mRNA. Translation: BAD96432.1. Different termination. AL109984 Genomic DNA. Translation: CAB86405.2. AL109984, AL121771 Genomic DNA. Translation: CAI43095.1. AL109984, AL121771 Genomic DNA. Translation: CAM28323.1. AL121771, AL109984 Genomic DNA. Translation: CAI21789.1. AL121771, AL109984 Genomic DNA. Translation: CAM28264.1. CH471077 Genomic DNA. Translation: EAW75591.1. BC021087 mRNA. No translation available. |
| IPI | IPI00005020. IPI00414782. IPI00796082. |
| RefSeq | NP_955459.2. NM_199427.2. |
| UniGene | Hs.473082. |
3D structure databases | |
| ProteinModelPortal | Q9NTW7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NTW7. 2 interactions. |
Polymorphism databases | |
| DMDM | 30316391. |
Proteomic databases | |
| PRIDE | Q9NTW7. |
Protocols and materials databases | |
| DNASU | 55734. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361387; ENSP00000355179; ENSG00000020256. ENST00000371518; ENSP00000360573; ENSG00000020256. ENST00000371523; ENSP00000360578; ENSG00000020256. |
| GeneID | 55734. |
| KEGG | hsa:55734. |
| UCSC | uc002xwj.3. human. uc002xwk.3. human. |
Organism-specific databases | |
| CTD | 55734. |
| GeneCards | GC20M050668. |
| HGNC | HGNC:15940. ZFP64. |
| neXtProt | NX_Q9NTW7. |
| PharmGKB | PA38060. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG056373. |
| OMA | KDGPRES. |
| OrthoDB | EOG4JT053. |
Gene expression databases | |
| ArrayExpress | Q9NTW7. |
| Bgee | Q9NTW7. |
| CleanEx | HS_ZFP64. |
| Genevestigator | Q9NTW7. |
| GermOnline | ENSG00000020256. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 12 hits. |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 15 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 6 hits. PS50157. ZINC_FINGER_C2H2_2. 13 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55734. |
| NextBio | 60666. |
Entry information
| Entry name | ZF64B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NTW7 Secondary accession number(s): A2A2N4 Q9H9P1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
