Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NTW7 (ZF64B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 125. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 64 homolog, isoforms 3 and 4

Short name=Zfp-64
Alternative name(s):
Zinc finger protein 338
Gene names
Name:ZFP64
Synonyms:ZNF338
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length645 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 13 C2H2-type zinc fingers.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: Q9NTW7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 4 (identifier: Q9NTW7-2)

Also known as: ZNF338;

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-254: KHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHT → MSRRKQAKPQHLNSEEPRPARRECAEVAPQVAGEP
Isoform 1 (identifier: Q9NPA5-1)

The sequence of this isoform can be found in the external entry Q9NPA5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoform 2 (identifier: Q9NPA5-2)

The sequence of this isoform can be found in the external entry Q9NPA5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoform 5 (identifier: Q9NTW7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     411-415: DTPFQ → CCYVA
     416-645: Missing.
Isoform 6 (identifier: Q9NTW7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     16-18: IPG → S
     236-390: Missing.
     412-645: TPFQCWLCSA...EAPLEPSQDL → APFQCWLCSA...LLCPADSIPD
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 645645Zinc finger protein 64 homolog, isoforms 3 and 4
PRO_0000047308

Regions

Zinc finger175 – 19723C2H2-type 1
Zinc finger203 – 22523C2H2-type 2
Zinc finger231 – 25323C2H2-type 3
Zinc finger299 – 32426C2H2-type 4; atypical
Zinc finger330 – 35223C2H2-type 5
Zinc finger358 – 38023C2H2-type 6
Zinc finger386 – 40823C2H2-type 7
Zinc finger414 – 43623C2H2-type 8
Zinc finger442 – 46524C2H2-type 9
Zinc finger467 – 48923C2H2-type 10
Zinc finger495 – 51723C2H2-type 11
Zinc finger523 – 54624C2H2-type 12
Zinc finger580 – 60223C2H2-type 13

Sites

Metal binding4971Zinc 1 By similarity
Metal binding5001Zinc 1 By similarity
Metal binding5131Zinc 1 By similarity
Metal binding5171Zinc 1 By similarity
Metal binding5251Zinc 2 By similarity
Metal binding5281Zinc 2 By similarity
Metal binding5411Zinc 2 By similarity
Metal binding5461Zinc 2 By similarity

Natural variations

Alternative sequence1 – 219219Missing in isoform 4.
VSP_007285
Alternative sequence16 – 183IPG → S in isoform 6.
VSP_046896
Alternative sequence220 – 25435KHLRI…LRSHT → MSRRKQAKPQHLNSEEPRPA RRECAEVAPQVAGEP in isoform 4.
VSP_007286
Alternative sequence236 – 390155Missing in isoform 6.
VSP_046897
Alternative sequence411 – 4155DTPFQ → CCYVA in isoform 5.
VSP_038213
Alternative sequence412 – 645234TPFQC…PSQDL → APFQCWLCSAKFKISSDLKR HMRVHSGEKPFKCEFCNVRC TMKGNLKSHIRIKHSGNNFK CPHCDFLGDSKATLRKHSRV HQSEHPEKCSECSYSCSSKA ALRIHERIHCTDRPFKCNYC SFDTKQPSNLSKHMKKFHGD MVKTEALERKDTGRQSSRQV AKLDAKKSFHCDICDASFMR EDSLRSHKRQHSEYSESKNS DVTVLQFQIDPSKQPATPLT VGHLQVPLQPSQVPQFSEGR VKIIVGHQVPQANTIVQAAA AAVNIVPPALVAQNPEELPG NSRLQILRQVSLIAPPQSSR CPSEAGAMTQPAVLLTTHEQ TDGATLHQTLIPTASGGPQE GSGNQTFITSSGITCTDFEG LNALIQEGTAEVTVVSDGGQ NIAVATTAPPVFSSSSQQEL PKQTYSIIQGAAHPALLCPA DSIPD in isoform 6.
VSP_046898
Alternative sequence416 – 645230Missing in isoform 5.
VSP_038214
Natural variant5931D → E in a breast cancer sample; somatic mutation. Ref.7
VAR_035564
Natural variant6091K → N in a breast cancer sample; somatic mutation. Ref.7
VAR_035565

Experimental info

Sequence conflict2401S → G in BAD96432. Ref.3
Sequence conflict5211R → C in AAP88762. Ref.2
Sequence conflict5211R → C in BC021087. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified April 30, 2003. Version 3.
Checksum: D7D336A59C128CC0

FASTA64572,217
        10         20         30         40         50         60 
MNASSEGESF AGSVQIPGGT TVLVELTPDI HICGICKQQF NNLDAFVAHK QSGCQLTGTS 

        70         80         90        100        110        120 
AAAPSTVQFV SEETVPATQT QTTTRTITSE TQTITVSAPE FVFEHGYQTY LPTESNENQT 

       130        140        150        160        170        180 
ATVISLPAKS RTKKPTTPPA QKRLNCCYPG CQFKTAYGMK DMERHLKIHT GDKPHKCEVC 

       190        200        210        220        230        240 
GKCFSRKDKL KTHMRCHTGV KPYKCKTCDY AAADSSSLNK HLRIHSDERP FKCQICPYAS 

       250        260        270        280        290        300 
RNSSQLTVHL RSHTASELDD DVPKANCLST ESTDTPKAPV ITLPSEAREQ MATLGERTFN 

       310        320        330        340        350        360 
CCYPGCHFKT VHGMKDLDRH LRIHTGDKPH KCEFCDKCFS RKDNLTMHMR CHTSVKPHKC 

       370        380        390        400        410        420 
HLCDYAAVDS SSLKKHLRIH SDERPYKCQL CPYASRNSSQ LTVHLRSHTG DTPFQCWLCS 

       430        440        450        460        470        480 
AKFKISSDLK RHMIVHSGEK PFKCEFCDVR CTMKANLKSH IRIKHTFKCL HCAFQGRDRA 

       490        500        510        520        530        540 
DLLEHSRLHQ ADHPEKCPEC SYSCSSAAAL RVHSRVHCKD RPFKCDFCSF DTKRPSSLAK 

       550        560        570        580        590        600 
HVDKVHRDEA KTENRAPLGK EGLREGSSQH VAKIVTQRAF RCETCGASFV RDDSLRCHKK 

       610        620        630        640 
QHSDQSENKN SDLVTFPPES GASGQLSTLV SVGQLEAPLE PSQDL 

« Hide

Isoform 4 (ZNF338) [UniParc].

Checksum: 1058B24E5147E9C7
Show »

FASTA42648,165
Isoform 1 [UniParc].

See Q9NPA5.

Isoform 2 [UniParc].

See Q9NPA5.

Isoform 5 [UniParc].

Checksum: FF37B0E6DE035CF7
Show »

FASTA41546,253
Isoform 6 [UniParc].

Checksum: ED2C59DD4F6BEC4D
Show »

FASTA67974,463

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Teratocarcinoma.
[2]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[3]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Colon.
[4]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Lymph.
[7]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLU-593 AND ASN-609.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK022690 mRNA. Translation: BAB14182.1.
BT009760 mRNA. Translation: AAP88762.1.
AK222712 mRNA. Translation: BAD96432.1. Different termination.
AL109984 Genomic DNA. Translation: CAB86405.2.
AL109984, AL121771 Genomic DNA. Translation: CAI43095.1.
AL109984, AL121771 Genomic DNA. Translation: CAM28323.1.
AL121771, AL109984 Genomic DNA. Translation: CAI21789.1.
AL121771, AL109984 Genomic DNA. Translation: CAM28264.1.
AL121923 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW75591.1.
BC021087 mRNA. No translation available.
RefSeqNP_955459.2. NM_199427.2.
XP_005260507.1. XM_005260450.1.
UniGeneHs.473082.

3D structure databases

ProteinModelPortalQ9NTW7.
SMRQ9NTW7. Positions 63-603.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120853. 13 interactions.
IntActQ9NTW7. 2 interactions.

Polymorphism databases

DMDM30316391.

Proteomic databases

PRIDEQ9NTW7.

Protocols and materials databases

DNASU55734.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000361387; ENSP00000355179; ENSG00000020256. [Q9NTW7-1]
ENST00000371515; ENSP00000360570; ENSG00000020256. [Q9NTW7-4]
ENST00000371518; ENSP00000360573; ENSG00000020256. [Q9NTW7-3]
ENST00000371523; ENSP00000360578; ENSG00000020256. [Q9NTW7-2]
GeneID55734.
KEGGhsa:55734.
UCSCuc002xwj.3. human. [Q9NTW7-2]
uc002xwk.3. human. [Q9NTW7-1]

Organism-specific databases

CTD55734.
GeneCardsGC20M050668.
HGNCHGNC:15940. ZFP64.
neXtProtNX_Q9NTW7.
PharmGKBPA38060.
GenAtlasSearch...

Phylogenomic databases

HOVERGENHBG056373.
OMAHMAKIVT.

Gene expression databases

ArrayExpressQ9NTW7.
BgeeQ9NTW7.
CleanExHS_ZFP64.
GenevestigatorQ9NTW7.

Family and domain databases

Gene3D3.30.160.60. 12 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi55734.
NextBio60666.

Entry information

Entry nameZF64B_HUMAN
AccessionPrimary (citable) accession number: Q9NTW7
Secondary accession number(s): A2A2N4 expand/collapse secondary AC list , Q53H69, Q53XQ1, Q5JWM0, Q5JWM1, Q8WU98, Q9H9P1
Entry history
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: April 30, 2003
Last modified: March 19, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM