Q9NTK5 (OLA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Obg-like ATPase 1 EC=3.6.3.- Alternative name(s): GTP-binding protein 9 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 396 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP. |
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subunit structure | Monomer. Ref.9 |
| Sequence similarities | Belongs to the GTP1/OBG family. Contains 1 G (guanine nucleotide-binding) domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | ATP catabolic process Inferred from direct assay Ref.9. Source: HGNC |
| Cellular component | cytoplasm Inferred from direct assay. Source: LIFEdb |
| Molecular function | ATP binding Inferred from direct assay Ref.9. Source: HGNC GTP bindingInferred from electronic annotation. Source: InterPro hydrolase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NTK5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NTK5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-158: Missing. | ||||||
| Isoform 3 (identifier: Q9NTK5-3) The sequence of this isoform differs from the canonical sequence as follows: 245-278: IKIKEWVDKYDPGALVIPFSGALELKLQELSAEE → LESTDNKAEIILLKMEILSSSNLTHLNNRRRNKI 279-396: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 396 | 396 | Obg-like ATPase 1 | PRO_0000122456 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 34 – 158 | 125 | G | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 32 – 37 | 6 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 231 | 1 | ATP; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 216 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 242 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 294 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 158 | 158 | Missing in isoform 2. | VSP_002049 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 245 – 278 | 34 | IKIKE…LSAEE → LESTDNKAEIILLKMEILSS SNLTHLNNRRRNKI in isoform 3. | VSP_002050 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 279 – 396 | 118 | Missing in isoform 3. | VSP_002051 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 168 | 1 | E → Q in a breast cancer sample; somatic mutation. Ref.10 | VAR_036613 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 127 | 1 | F → A: Loss of ATP-binding. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 230 | 1 | N → A: Loss of ATP-binding. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 231 – 233 | 3 | LSE → KSD: Retention of ATP-binding specificity. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 33 | 1 | V → A in BAB55174. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 97 | 1 | V → A in AAD44500. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 254 | 1 | Y → C in CAB66481. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 391 | 1 | Q → R in AAF71123. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 19 – 21 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 25 – 28 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 34 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 43 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 65 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 78 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 84 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 92 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 115 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 117 – 125 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 142 – 165 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 192 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 217 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 222 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 230 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 238 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 254 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 259 – 263 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 265 – 273 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 276 – 285 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 302 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 305 – 322 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 327 – 332 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 337 – 341 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 342 – 348 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 350 – 356 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 359 – 364 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 369 – 371 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 382 – 387 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a new human cDNA homologous to Caenorhabditis elegans putative GTP-binding protein." Yue P., Yu L., Zhao S.Y. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Amygdala. |
| [3] | "Human homologous yeast-44.2 protein, complete cds." Zhang Q., Huang Q., Song H., Peng J., Fu G., Mao M., Dai M., Mao Y., Zhou J., Chen Z., Chen J., Luo M., Hu R. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pituitary tumor. |
| [4] | "Functional prediction of the coding sequences of 121 new genes deduced by analysis of cDNA clones from human fetal liver." Zhang C., Yu Y., Zhang S., Wei H., Zhou G., Ouyang S., Luo L., Bi J., Liu M., He F. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal liver. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Teratocarcinoma. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain, Ovary, Testis and Urinary bladder. |
| [7] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-216; LYS-242 AND LYS-294, MASS SPECTROMETRY. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins." Koller-Eichhorn R., Marquardt T., Gail R., Wittinghofer A., Kostrewa D., Kutay U., Kambach C. J. Biol. Chem. 282:19928-19937(2007) [PubMed: 17430889] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) IN COMPLEX WITH ATP ANALOG, SUBUNIT, MUTAGENESIS OF PHE-127; ASN-230 AND 231-LEU--GLU-233. |
| [10] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-168. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF134478 mRNA. Translation: AAP97255.1. AL136546 mRNA. Translation: CAB66481.1. AF078859 mRNA. Translation: AAD44491.1. AF078868 mRNA. Translation: AAD44500.1. AF116703 mRNA. Translation: AAF71123.1. AK027523 mRNA. Translation: BAB55174.1. AK074710 mRNA. Translation: BAC11153.1. BC012842 mRNA. Translation: AAH12842.1. BC013925 mRNA. Translation: AAH13925.1. BC029376 mRNA. Translation: AAH29376.1. BC091522 mRNA. Translation: AAH91522.1. | ||||||||||||
| IPI | IPI00216105. IPI00216106. IPI00290416. | ||||||||||||
| PIR | T46901. | ||||||||||||
| RefSeq | NP_001011708.1. NM_001011708.1. NP_037473.3. NM_013341.3. | ||||||||||||
| UniGene | Hs.157351. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NTK5. | ||||||||||||
| SMR | Q9NTK5. Positions 16-388. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NTK5. 4 interactions. | ||||||||||||
| MINT | MINT-1407274. | ||||||||||||
| STRING | Q9NTK5. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NTK5. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 25453240. | ||||||||||||
2D gel databases | |||||||||||||
| OGP | Q9NTK5. | ||||||||||||
| UCD-2DPAGE | Q9NTK5. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NTK5. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000284719; ENSP00000284719; ENSG00000138430. ENST00000409546; ENSP00000386350; ENSG00000138430. | ||||||||||||
| GeneID | 29789. | ||||||||||||
| KEGG | hsa:29789. | ||||||||||||
| UCSC | uc002uih.1. human. uc010fqr.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 29789. | ||||||||||||
| GeneCards | GC02M174937. | ||||||||||||
| H-InvDB | HIX0020292. | ||||||||||||
| HGNC | HGNC:28833. OLA1. | ||||||||||||
| HPA | HPA035790. | ||||||||||||
| MIM | 611175. gene. | ||||||||||||
| neXtProt | NX_Q9NTK5. | ||||||||||||
| PharmGKB | PA162398388. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000000673. | ||||||||||||
| HOVERGEN | HBG031861. | ||||||||||||
| InParanoid | Q9NTK5. | ||||||||||||
| OrthoDB | EOG4C2H9M. | ||||||||||||
| PhylomeDB | Q9NTK5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NTK5. | ||||||||||||
| Bgee | Q9NTK5. | ||||||||||||
| CleanEx | HS_OLA1. | ||||||||||||
| Genevestigator | Q9NTK5. | ||||||||||||
| GermOnline | ENSG00000138430. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012675. Beta-grasp_ferredoxin-type. IPR004396. CHP00092. IPR013029. DUF933. IPR006073. GTP_binding_domain. IPR012676. TGS-like. IPR023192. TGS-like_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.10.20.30. Ferredoxin_fold. 1 hit. G3DSA:1.10.150.300. G3DSA:1.10.150.300. 1 hit. | ||||||||||||
| KO | K06942. | ||||||||||||
| Pfam | PF01926. MMR_HSR1. 1 hit. PF06071. YchF-GTPase_C. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF006641. CHP00092. 1 hit. | ||||||||||||
| PRINTS | PR00326. GTP1OBG. | ||||||||||||
| SUPFAM | SSF81271. TGS-like. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR00092. TIGR00092. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 52323. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | OLA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NTK5 Secondary accession number(s): Q5BJD7 Q9Y6G4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with