Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Obg-like ATPase 1

Gene

OLA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.UniRule annotation

Cofactori

Mg2+PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi36MagnesiumPROSITE-ProRule annotation1
Metal bindingi56MagnesiumPROSITE-ProRule annotation1
Binding sitei231ATP; via carbonyl oxygen1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi32 – 37ATP1 Publication6

GO - Molecular functioni

  • ATPase activity Source: BHF-UCL
  • ATP binding Source: HGNC
  • cadherin binding Source: BHF-UCL
  • GTP binding Source: InterPro
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • ATP metabolic process Source: BHF-UCL
  • platelet degranulation Source: Reactome

Keywordsi

Molecular functionHydrolase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-114608 Platelet degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
Obg-like ATPase 1UniRule annotation
Alternative name(s):
DNA damage-regulated overexpressed in cancer 45
Short name:
DOC45
GTP-binding protein 9
Gene namesi
Name:OLA1UniRule annotation
Synonyms:GTPBP9
ORF Names:PRO2455, PTD004
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138430.15
HGNCiHGNC:28833 OLA1
MIMi611175 gene
neXtProtiNX_Q9NTK5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi127F → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi230N → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi231 – 233LSE → KSD: Retention of ATP-binding specificity. 1 Publication3

Organism-specific databases

DisGeNETi29789
OpenTargetsiENSG00000138430
PharmGKBiPA162398388

Polymorphism and mutation databases

BioMutaiOLA1
DMDMi25453240

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001224561 – 396Obg-like ATPase 1Add BLAST396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei294N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NTK5
MaxQBiQ9NTK5
PaxDbiQ9NTK5
PeptideAtlasiQ9NTK5
PRIDEiQ9NTK5

2D gel databases

OGPiQ9NTK5
UCD-2DPAGEiQ9NTK5

PTM databases

iPTMnetiQ9NTK5
PhosphoSitePlusiQ9NTK5
SwissPalmiQ9NTK5

Expressioni

Tissue specificityi

Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.

Inductioni

Strongly down-regulated by DNA damage-inducing agents.1 Publication

Gene expression databases

BgeeiENSG00000138430
CleanExiHS_OLA1
ExpressionAtlasiQ9NTK5 baseline and differential
GenevisibleiQ9NTK5 HS

Organism-specific databases

HPAiHPA035790
HPA041443

Interactioni

Subunit structurei

Monomer.UniRule annotation1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
gagP045914EBI-766468,EBI-6179719From Human immunodeficiency virus type 1 group M subtype B (isolate HXB2).

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi118917, 55 interactors
DIPiDIP-34591N
IntActiQ9NTK5, 25 interactors
MINTiQ9NTK5
STRINGi9606.ENSP00000284719

Structurei

Secondary structure

1396
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi19 – 21Combined sources3
Beta strandi25 – 28Combined sources4
Beta strandi31 – 34Combined sources4
Helixi35 – 43Combined sources9
Beta strandi60 – 65Combined sources6
Helixi69 – 78Combined sources10
Beta strandi81 – 84Combined sources4
Beta strandi87 – 92Combined sources6
Helixi109 – 115Combined sources7
Beta strandi117 – 125Combined sources9
Helixi142 – 165Combined sources24
Helixi182 – 192Combined sources11
Helixi200 – 202Combined sources3
Helixi208 – 217Combined sources10
Helixi220 – 222Combined sources3
Beta strandi225 – 230Combined sources6
Helixi233 – 238Combined sources6
Helixi242 – 254Combined sources13
Beta strandi259 – 263Combined sources5
Helixi265 – 273Combined sources9
Helixi276 – 285Combined sources10
Helixi292 – 302Combined sources11
Beta strandi305 – 322Combined sources18
Helixi327 – 332Combined sources6
Helixi337 – 341Combined sources5
Beta strandi342 – 348Combined sources7
Helixi350 – 356Combined sources7
Helixi359 – 364Combined sources6
Beta strandi369 – 371Combined sources3
Beta strandi382 – 387Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OHFX-ray2.70A1-396[»]
ProteinModelPortaliQ9NTK5
SMRiQ9NTK5
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NTK5

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 283OBG-type GPROSITE-ProRule annotationAdd BLAST261

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi267 – 274Nuclear export signalUniRule annotation8

Sequence similaritiesi

Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.UniRule annotation

Phylogenomic databases

eggNOGiKOG1491 Eukaryota
COG0012 LUCA
GeneTreeiENSGT00390000000673
HOVERGENiHBG031861
InParanoidiQ9NTK5
KOiK19788
PhylomeDBiQ9NTK5
TreeFamiTF300774

Family and domain databases

Gene3Di1.10.150.300, 1 hit
3.10.20.30, 2 hits
HAMAPiMF_00944 YchF_OLA1_ATPase, 1 hit
InterProiView protein in InterPro
IPR004396 ATPase_YchF/OLA1
IPR012675 Beta-grasp_dom_sf
IPR031167 G_OBG
IPR006073 GTP_binding_domain
IPR027417 P-loop_NTPase
IPR012676 TGS-like
IPR023192 TGS-like_dom_sf
IPR013029 YchF_C
PfamiView protein in Pfam
PF01926 MMR_HSR1, 1 hit
PF06071 YchF-GTPase_C, 1 hit
PIRSFiPIRSF006641 CHP00092, 1 hit
PRINTSiPR00326 GTP1OBG
SUPFAMiSSF52540 SSF52540, 1 hit
SSF81271 SSF81271, 1 hit
TIGRFAMsiTIGR00092 TIGR00092, 1 hit
PROSITEiView protein in PROSITE
PS51710 G_OBG, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NTK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPKKGGDGI KPPPIIGRFG TSLKIGIVGL PNVGKSTFFN VLTNSQASAE
60 70 80 90 100
NFPFCTIDPN ESRVPVPDER FDFLCQYHKP ASKIPAFLNV VDIAGLVKGA
110 120 130 140 150
HNGQGLGNAF LSHISACDGI FHLTRAFEDD DITHVEGSVD PIRDIEIIHE
160 170 180 190 200
ELQLKDEEMI GPIIDKLEKV AVRGGDKKLK PEYDIMCKVK SWVIDQKKPV
210 220 230 240 250
RFYHDWNDKE IEVLNKHLFL TSKPMVYLVN LSEKDYIRKK NKWLIKIKEW
260 270 280 290 300
VDKYDPGALV IPFSGALELK LQELSAEERQ KYLEANMTQS ALPKIIKAGF
310 320 330 340 350
AALQLEYFFT AGPDEVRAWT IRKGTKAPQA AGKIHTDFEK GFIMAEVMKY
360 370 380 390
EDFKEEGSEN AVKAAGKYRQ QGRNYIVEDG DIIFFKFNTP QQPKKK
Length:396
Mass (Da):44,744
Last modified:November 25, 2002 - v2
Checksum:i4C7629BFC27CBEB2
GO
Isoform 2 (identifier: Q9NTK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-158: Missing.

Show »
Length:238
Mass (Da):27,584
Checksum:i33A74AFEC0331464
GO
Isoform 3 (identifier: Q9NTK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-278: IKIKEWVDKYDPGALVIPFSGALELKLQELSAEE → LESTDNKAEIILLKMEILSSSNLTHLNNRRRNKI
     279-396: Missing.

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):31,440
Checksum:iDDB37373907EB18D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33V → A in BAB55174 (PubMed:14702039).Curated1
Sequence conflicti97V → A in AAD44500 (Ref. 4) Curated1
Sequence conflicti254Y → C in CAB66481 (PubMed:11230166).Curated1
Sequence conflicti391Q → R in AAF71123 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036613168E → Q in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0020491 – 158Missing in isoform 2. 2 PublicationsAdd BLAST158
Alternative sequenceiVSP_002050245 – 278IKIKE…LSAEE → LESTDNKAEIILLKMEILSS SNLTHLNNRRRNKI in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_002051279 – 396Missing in isoform 3. 1 PublicationAdd BLAST118

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ250006 mRNA Translation: ABB72766.1
AF134478 mRNA Translation: AAP97255.1
AL136546 mRNA Translation: CAB66481.1
AF078859 mRNA Translation: AAD44491.1
AF078868 mRNA Translation: AAD44500.1
AF116703 mRNA Translation: AAF71123.1
AK027523 mRNA Translation: BAB55174.1
AK074710 mRNA Translation: BAC11153.1
CH471058 Genomic DNA Translation: EAX11151.1
BC012842 mRNA Translation: AAH12842.1
BC013925 mRNA Translation: AAH13925.1
BC029376 mRNA Translation: AAH29376.1
BC091522 mRNA Translation: AAH91522.1
CCDSiCCDS2255.1 [Q9NTK5-1]
CCDS42779.1 [Q9NTK5-2]
PIRiT46901
RefSeqiNP_001011708.1, NM_001011708.2 [Q9NTK5-2]
NP_037473.3, NM_013341.4 [Q9NTK5-1]
UniGeneiHs.157351

Genome annotation databases

EnsembliENST00000284719; ENSP00000284719; ENSG00000138430 [Q9NTK5-1]
ENST00000344357; ENSP00000340167; ENSG00000138430 [Q9NTK5-2]
ENST00000428402; ENSP00000410385; ENSG00000138430 [Q9NTK5-3]
GeneIDi29789
KEGGihsa:29789
UCSCiuc002uih.4 human [Q9NTK5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiOLA1_HUMAN
AccessioniPrimary (citable) accession number: Q9NTK5
Secondary accession number(s): D7EHM2
, Q5BJD7, Q8NCI8, Q96CU1, Q96SV2, Q9P1D3, Q9UNY9, Q9Y6G4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: April 25, 2018
This is version 169 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health