Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Obg-like ATPase 1

Gene

OLA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.UniRule annotation

Cofactori

Mg2+PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi36MagnesiumPROSITE-ProRule annotation1
Metal bindingi56MagnesiumPROSITE-ProRule annotation1
Binding sitei231ATP; via carbonyl oxygen1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi32 – 37ATP1 Publication6

GO - Molecular functioni

  • ATPase activity Source: BHF-UCL
  • ATP binding Source: HGNC
  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • GTP binding Source: InterPro
  • metal ion binding Source: UniProtKB-KW
  • ribosomal large subunit binding Source: UniProtKB-HAMAP
  • ribosome binding Source: UniProtKB-HAMAP

GO - Biological processi

  • ATP metabolic process Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138430-MONOMER.
ReactomeiR-HSA-114608. Platelet degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Obg-like ATPase 1UniRule annotation
Alternative name(s):
DNA damage-regulated overexpressed in cancer 45
Short name:
DOC45
GTP-binding protein 9
Gene namesi
Name:OLA1UniRule annotation
Synonyms:GTPBP9
ORF Names:PRO2455, PTD004
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:28833. OLA1.

Subcellular locationi

  • Cytoplasm UniRule annotation1 Publication
  • Nucleus UniRule annotation1 Publication
  • Nucleusnucleolus UniRule annotation1 Publication

  • Note: Predominantly cytoplasmic, shuttles between the nucleus and the cytoplasm.UniRule annotation

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • centrosome Source: HPA
  • cytoplasm Source: LIFEdb
  • extracellular exosome Source: UniProtKB
  • membrane Source: UniProtKB
  • nucleolus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi127F → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi230N → A: Loss of ATP-binding. 1 Publication1
Mutagenesisi231 – 233LSE → KSD: Retention of ATP-binding specificity. 1 Publication3

Organism-specific databases

DisGeNETi29789.
OpenTargetsiENSG00000138430.
PharmGKBiPA162398388.

Polymorphism and mutation databases

BioMutaiOLA1.
DMDMi25453240.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001224561 – 396Obg-like ATPase 1Add BLAST396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei294N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NTK5.
MaxQBiQ9NTK5.
PaxDbiQ9NTK5.
PeptideAtlasiQ9NTK5.
PRIDEiQ9NTK5.

2D gel databases

OGPiQ9NTK5.
UCD-2DPAGEQ9NTK5.

PTM databases

iPTMnetiQ9NTK5.
PhosphoSitePlusiQ9NTK5.
SwissPalmiQ9NTK5.

Expressioni

Tissue specificityi

Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.

Inductioni

Strongly down-regulated by DNA damage-inducing agents.1 Publication

Gene expression databases

BgeeiENSG00000138430.
CleanExiHS_OLA1.
ExpressionAtlasiQ9NTK5. baseline and differential.
GenevisibleiQ9NTK5. HS.

Organism-specific databases

HPAiHPA035790.
HPA041443.

Interactioni

Subunit structurei

Monomer.UniRule annotation1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
gagP045914EBI-766468,EBI-6179719From a different organism.

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi118917. 42 interactors.
IntActiQ9NTK5. 12 interactors.
MINTiMINT-1407274.
STRINGi9606.ENSP00000284719.

Structurei

Secondary structure

1396
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi19 – 21Combined sources3
Beta strandi25 – 28Combined sources4
Beta strandi31 – 34Combined sources4
Helixi35 – 43Combined sources9
Beta strandi60 – 65Combined sources6
Helixi69 – 78Combined sources10
Beta strandi81 – 84Combined sources4
Beta strandi87 – 92Combined sources6
Helixi109 – 115Combined sources7
Beta strandi117 – 125Combined sources9
Helixi142 – 165Combined sources24
Helixi182 – 192Combined sources11
Helixi200 – 202Combined sources3
Helixi208 – 217Combined sources10
Helixi220 – 222Combined sources3
Beta strandi225 – 230Combined sources6
Helixi233 – 238Combined sources6
Helixi242 – 254Combined sources13
Beta strandi259 – 263Combined sources5
Helixi265 – 273Combined sources9
Helixi276 – 285Combined sources10
Helixi292 – 302Combined sources11
Beta strandi305 – 322Combined sources18
Helixi327 – 332Combined sources6
Helixi337 – 341Combined sources5
Beta strandi342 – 348Combined sources7
Helixi350 – 356Combined sources7
Helixi359 – 364Combined sources6
Beta strandi369 – 371Combined sources3
Beta strandi382 – 387Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OHFX-ray2.70A1-396[»]
ProteinModelPortaliQ9NTK5.
SMRiQ9NTK5.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NTK5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 283OBG-type GPROSITE-ProRule annotationAdd BLAST261

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi267 – 274Nuclear export signalUniRule annotation8

Sequence similaritiesi

Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. YchF/OLA1 subfamily.UniRule annotation
Contains 1 OBG-type G (guanine nucleotide-binding) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1491. Eukaryota.
COG0012. LUCA.
GeneTreeiENSGT00390000000673.
HOVERGENiHBG031861.
InParanoidiQ9NTK5.
KOiK19788.
PhylomeDBiQ9NTK5.
TreeFamiTF300774.

Family and domain databases

Gene3Di1.10.150.300. 1 hit.
3.10.20.30. 1 hit.
3.40.50.300. 2 hits.
HAMAPiMF_00944. YchF_OLA1_ATPase. 1 hit.
InterProiIPR004396. ATPase_YchF/OLA1.
IPR012675. Beta-grasp_dom.
IPR013029. DUF933.
IPR031167. G_OBG.
IPR006073. GTP_binding_domain.
IPR027417. P-loop_NTPase.
IPR012676. TGS-like.
IPR023192. TGS-like_dom.
[Graphical view]
PfamiPF01926. MMR_HSR1. 1 hit.
PF06071. YchF-GTPase_C. 1 hit.
[Graphical view]
PIRSFiPIRSF006641. CHP00092. 1 hit.
PRINTSiPR00326. GTP1OBG.
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF81271. SSF81271. 1 hit.
TIGRFAMsiTIGR00092. TIGR00092. 1 hit.
PROSITEiPS51710. G_OBG. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NTK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPPKKGGDGI KPPPIIGRFG TSLKIGIVGL PNVGKSTFFN VLTNSQASAE
60 70 80 90 100
NFPFCTIDPN ESRVPVPDER FDFLCQYHKP ASKIPAFLNV VDIAGLVKGA
110 120 130 140 150
HNGQGLGNAF LSHISACDGI FHLTRAFEDD DITHVEGSVD PIRDIEIIHE
160 170 180 190 200
ELQLKDEEMI GPIIDKLEKV AVRGGDKKLK PEYDIMCKVK SWVIDQKKPV
210 220 230 240 250
RFYHDWNDKE IEVLNKHLFL TSKPMVYLVN LSEKDYIRKK NKWLIKIKEW
260 270 280 290 300
VDKYDPGALV IPFSGALELK LQELSAEERQ KYLEANMTQS ALPKIIKAGF
310 320 330 340 350
AALQLEYFFT AGPDEVRAWT IRKGTKAPQA AGKIHTDFEK GFIMAEVMKY
360 370 380 390
EDFKEEGSEN AVKAAGKYRQ QGRNYIVEDG DIIFFKFNTP QQPKKK
Length:396
Mass (Da):44,744
Last modified:November 25, 2002 - v2
Checksum:i4C7629BFC27CBEB2
GO
Isoform 2 (identifier: Q9NTK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-158: Missing.

Show »
Length:238
Mass (Da):27,584
Checksum:i33A74AFEC0331464
GO
Isoform 3 (identifier: Q9NTK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-278: IKIKEWVDKYDPGALVIPFSGALELKLQELSAEE → LESTDNKAEIILLKMEILSSSNLTHLNNRRRNKI
     279-396: Missing.

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):31,440
Checksum:iDDB37373907EB18D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33V → A in BAB55174 (PubMed:14702039).Curated1
Sequence conflicti97V → A in AAD44500 (Ref. 4) Curated1
Sequence conflicti254Y → C in CAB66481 (PubMed:11230166).Curated1
Sequence conflicti391Q → R in AAF71123 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036613168E → Q in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0020491 – 158Missing in isoform 2. 2 PublicationsAdd BLAST158
Alternative sequenceiVSP_002050245 – 278IKIKE…LSAEE → LESTDNKAEIILLKMEILSS SNLTHLNNRRRNKI in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_002051279 – 396Missing in isoform 3. 1 PublicationAdd BLAST118

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ250006 mRNA. Translation: ABB72766.1.
AF134478 mRNA. Translation: AAP97255.1.
AL136546 mRNA. Translation: CAB66481.1.
AF078859 mRNA. Translation: AAD44491.1.
AF078868 mRNA. Translation: AAD44500.1.
AF116703 mRNA. Translation: AAF71123.1.
AK027523 mRNA. Translation: BAB55174.1.
AK074710 mRNA. Translation: BAC11153.1.
CH471058 Genomic DNA. Translation: EAX11151.1.
BC012842 mRNA. Translation: AAH12842.1.
BC013925 mRNA. Translation: AAH13925.1.
BC029376 mRNA. Translation: AAH29376.1.
BC091522 mRNA. Translation: AAH91522.1.
CCDSiCCDS2255.1. [Q9NTK5-1]
CCDS42779.1. [Q9NTK5-2]
PIRiT46901.
RefSeqiNP_001011708.1. NM_001011708.2. [Q9NTK5-2]
NP_037473.3. NM_013341.4. [Q9NTK5-1]
UniGeneiHs.157351.

Genome annotation databases

EnsembliENST00000284719; ENSP00000284719; ENSG00000138430. [Q9NTK5-1]
ENST00000344357; ENSP00000340167; ENSG00000138430. [Q9NTK5-2]
ENST00000428402; ENSP00000410385; ENSG00000138430. [Q9NTK5-3]
GeneIDi29789.
KEGGihsa:29789.
UCSCiuc002uih.4. human. [Q9NTK5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ250006 mRNA. Translation: ABB72766.1.
AF134478 mRNA. Translation: AAP97255.1.
AL136546 mRNA. Translation: CAB66481.1.
AF078859 mRNA. Translation: AAD44491.1.
AF078868 mRNA. Translation: AAD44500.1.
AF116703 mRNA. Translation: AAF71123.1.
AK027523 mRNA. Translation: BAB55174.1.
AK074710 mRNA. Translation: BAC11153.1.
CH471058 Genomic DNA. Translation: EAX11151.1.
BC012842 mRNA. Translation: AAH12842.1.
BC013925 mRNA. Translation: AAH13925.1.
BC029376 mRNA. Translation: AAH29376.1.
BC091522 mRNA. Translation: AAH91522.1.
CCDSiCCDS2255.1. [Q9NTK5-1]
CCDS42779.1. [Q9NTK5-2]
PIRiT46901.
RefSeqiNP_001011708.1. NM_001011708.2. [Q9NTK5-2]
NP_037473.3. NM_013341.4. [Q9NTK5-1]
UniGeneiHs.157351.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OHFX-ray2.70A1-396[»]
ProteinModelPortaliQ9NTK5.
SMRiQ9NTK5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118917. 42 interactors.
IntActiQ9NTK5. 12 interactors.
MINTiMINT-1407274.
STRINGi9606.ENSP00000284719.

PTM databases

iPTMnetiQ9NTK5.
PhosphoSitePlusiQ9NTK5.
SwissPalmiQ9NTK5.

Polymorphism and mutation databases

BioMutaiOLA1.
DMDMi25453240.

2D gel databases

OGPiQ9NTK5.
UCD-2DPAGEQ9NTK5.

Proteomic databases

EPDiQ9NTK5.
MaxQBiQ9NTK5.
PaxDbiQ9NTK5.
PeptideAtlasiQ9NTK5.
PRIDEiQ9NTK5.

Protocols and materials databases

DNASUi29789.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000284719; ENSP00000284719; ENSG00000138430. [Q9NTK5-1]
ENST00000344357; ENSP00000340167; ENSG00000138430. [Q9NTK5-2]
ENST00000428402; ENSP00000410385; ENSG00000138430. [Q9NTK5-3]
GeneIDi29789.
KEGGihsa:29789.
UCSCiuc002uih.4. human. [Q9NTK5-1]

Organism-specific databases

CTDi29789.
DisGeNETi29789.
GeneCardsiOLA1.
HGNCiHGNC:28833. OLA1.
HPAiHPA035790.
HPA041443.
MIMi611175. gene.
neXtProtiNX_Q9NTK5.
OpenTargetsiENSG00000138430.
PharmGKBiPA162398388.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1491. Eukaryota.
COG0012. LUCA.
GeneTreeiENSGT00390000000673.
HOVERGENiHBG031861.
InParanoidiQ9NTK5.
KOiK19788.
PhylomeDBiQ9NTK5.
TreeFamiTF300774.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138430-MONOMER.
ReactomeiR-HSA-114608. Platelet degranulation.

Miscellaneous databases

ChiTaRSiOLA1. human.
EvolutionaryTraceiQ9NTK5.
GeneWikiiOLA1.
GenomeRNAii29789.
PROiQ9NTK5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138430.
CleanExiHS_OLA1.
ExpressionAtlasiQ9NTK5. baseline and differential.
GenevisibleiQ9NTK5. HS.

Family and domain databases

Gene3Di1.10.150.300. 1 hit.
3.10.20.30. 1 hit.
3.40.50.300. 2 hits.
HAMAPiMF_00944. YchF_OLA1_ATPase. 1 hit.
InterProiIPR004396. ATPase_YchF/OLA1.
IPR012675. Beta-grasp_dom.
IPR013029. DUF933.
IPR031167. G_OBG.
IPR006073. GTP_binding_domain.
IPR027417. P-loop_NTPase.
IPR012676. TGS-like.
IPR023192. TGS-like_dom.
[Graphical view]
PfamiPF01926. MMR_HSR1. 1 hit.
PF06071. YchF-GTPase_C. 1 hit.
[Graphical view]
PIRSFiPIRSF006641. CHP00092. 1 hit.
PRINTSiPR00326. GTP1OBG.
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF81271. SSF81271. 1 hit.
TIGRFAMsiTIGR00092. TIGR00092. 1 hit.
PROSITEiPS51710. G_OBG. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiOLA1_HUMAN
AccessioniPrimary (citable) accession number: Q9NTK5
Secondary accession number(s): D7EHM2
, Q5BJD7, Q8NCI8, Q96CU1, Q96SV2, Q9P1D3, Q9UNY9, Q9Y6G4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: November 25, 2002
Last modified: November 30, 2016
This is version 159 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.