Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NSY2

- STAR5_HUMAN

UniProt

Q9NSY2 - STAR5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

StAR-related lipid transfer protein 5

Gene

STARD5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity).By similarity

GO - Molecular functioni

  1. lipid binding Source: UniProtKB-KW

GO - Biological processi

  1. C21-steroid hormone biosynthetic process Source: Reactome
  2. lipid transport Source: UniProtKB-KW
  3. small molecule metabolic process Source: Reactome
  4. steroid metabolic process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

ReactomeiREACT_11038. Pregnenolone biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
StAR-related lipid transfer protein 5
Alternative name(s):
START domain-containing protein 5
Short name:
StARD5
Gene namesi
Name:STARD5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:18065. STARD5.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38286.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 213213StAR-related lipid transfer protein 5PRO_0000220669Add
BLAST

Proteomic databases

PaxDbiQ9NSY2.
PRIDEiQ9NSY2.

Expressioni

Gene expression databases

BgeeiQ9NSY2.
CleanExiHS_STARD5.
ExpressionAtlasiQ9NSY2. baseline and differential.
GenevestigatoriQ9NSY2.

Organism-specific databases

HPAiHPA040662.
HPA040682.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000304032.

Structurei

Secondary structure

1
213
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi6 – 2217Combined sources
Beta strandi28 – 314Combined sources
Beta strandi34 – 429Combined sources
Beta strandi44 – 5916Combined sources
Helixi61 – 688Combined sources
Helixi76 – 794Combined sources
Beta strandi84 – 918Combined sources
Beta strandi93 – 10210Combined sources
Turni107 – 1104Combined sources
Beta strandi114 – 12411Combined sources
Beta strandi130 – 1367Combined sources
Beta strandi149 – 1535Combined sources
Beta strandi155 – 1628Combined sources
Beta strandi170 – 1767Combined sources
Helixi186 – 20924Combined sources
Helixi210 – 2123Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2R55X-ray2.50A/B6-213[»]
ProteinModelPortaliQ9NSY2.
SMRiQ9NSY2. Positions 4-213.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NSY2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 213213STARTPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 START domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG255993.
GeneTreeiENSGT00530000063294.
HOGENOMiHOG000137345.
HOVERGENiHBG055194.
InParanoidiQ9NSY2.
OMAiCFCEPVP.
OrthoDBiEOG7353XV.
PhylomeDBiQ9NSY2.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PfamiPF01852. START. 1 hit.
[Graphical view]
SMARTiSM00234. START. 1 hit.
[Graphical view]
PROSITEiPS50848. START. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NSY2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDPALAAQMS EAVAEKMLQY RRDTAGWKIC REGNGVSVSW RPSVEFPGNL
60 70 80 90 100
YRGEGIVYGT LEEVWDCVKP AVGGLRVKWD ENVTGFEIIQ SITDTLCVSR
110 120 130 140 150
TSTPSAAMKL ISPRDFVDLV LVKRYEDGTI SSNATHVEHP LCPPKPGFVR
160 170 180 190 200
GFNHPCGCFC EPLPGEPTKT NLVTFFHTDL SGYLPQNVVD SFFPRSMTRF
210
YANLQKAVKQ FHE
Length:213
Mass (Da):23,794
Last modified:November 15, 2002 - v2
Checksum:iEE5547A7846AB3C4
GO
Isoform 2 (identifier: Q9NSY2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-63: NGVSVSWRPSVEFPGNLYRGEGIVYGTLEE → VPRRRHCIWDTRGGVGLCEASCWRPTSEVG
     64-213: Missing.

Note: No experimental confirmation available.

Show »
Length:63
Mass (Da):7,094
Checksum:i1D457C21C9A0FDE1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti74 – 741G → S.
Corresponds to variant rs4384572 [ dbSNP | Ensembl ].
VAR_052071

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei34 – 6330NGVSV…GTLEE → VPRRRHCIWDTRGGVGLCEA SCWRPTSEVG in isoform 2. 1 PublicationVSP_014871Add
BLAST
Alternative sequencei64 – 213150Missing in isoform 2. 1 PublicationVSP_014872Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF480304 mRNA. Translation: AAL89654.1.
AL137657 mRNA. Translation: CAB70862.2.
AK026352 mRNA. No translation available.
BC004365 mRNA. Translation: AAH04365.2.
CCDSiCCDS10318.1. [Q9NSY2-1]
PIRiT46357.
RefSeqiNP_871629.1. NM_181900.2. [Q9NSY2-1]
UniGeneiHs.513075.

Genome annotation databases

EnsembliENST00000302824; ENSP00000304032; ENSG00000172345. [Q9NSY2-1]
ENST00000325346; ENSP00000317519; ENSG00000172345. [Q9NSY2-3]
GeneIDi80765.
KEGGihsa:80765.
UCSCiuc002bgm.3. human. [Q9NSY2-1]

Polymorphism databases

DMDMi25091329.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF480304 mRNA. Translation: AAL89654.1 .
AL137657 mRNA. Translation: CAB70862.2 .
AK026352 mRNA. No translation available.
BC004365 mRNA. Translation: AAH04365.2 .
CCDSi CCDS10318.1. [Q9NSY2-1 ]
PIRi T46357.
RefSeqi NP_871629.1. NM_181900.2. [Q9NSY2-1 ]
UniGenei Hs.513075.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2R55 X-ray 2.50 A/B 6-213 [» ]
ProteinModelPortali Q9NSY2.
SMRi Q9NSY2. Positions 4-213.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000304032.

Polymorphism databases

DMDMi 25091329.

Proteomic databases

PaxDbi Q9NSY2.
PRIDEi Q9NSY2.

Protocols and materials databases

DNASUi 80765.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000302824 ; ENSP00000304032 ; ENSG00000172345 . [Q9NSY2-1 ]
ENST00000325346 ; ENSP00000317519 ; ENSG00000172345 . [Q9NSY2-3 ]
GeneIDi 80765.
KEGGi hsa:80765.
UCSCi uc002bgm.3. human. [Q9NSY2-1 ]

Organism-specific databases

CTDi 80765.
GeneCardsi GC15M081601.
HGNCi HGNC:18065. STARD5.
HPAi HPA040662.
HPA040682.
MIMi 607050. gene.
neXtProti NX_Q9NSY2.
PharmGKBi PA38286.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG255993.
GeneTreei ENSGT00530000063294.
HOGENOMi HOG000137345.
HOVERGENi HBG055194.
InParanoidi Q9NSY2.
OMAi CFCEPVP.
OrthoDBi EOG7353XV.
PhylomeDBi Q9NSY2.

Enzyme and pathway databases

Reactomei REACT_11038. Pregnenolone biosynthesis.

Miscellaneous databases

EvolutionaryTracei Q9NSY2.
GeneWikii STARD5.
GenomeRNAii 80765.
NextBioi 71151.
PROi Q9NSY2.
SOURCEi Search...

Gene expression databases

Bgeei Q9NSY2.
CleanExi HS_STARD5.
ExpressionAtlasi Q9NSY2. baseline and differential.
Genevestigatori Q9NSY2.

Family and domain databases

Gene3Di 3.30.530.20. 1 hit.
InterProi IPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view ]
Pfami PF01852. START. 1 hit.
[Graphical view ]
SMARTi SM00234. START. 1 hit.
[Graphical view ]
PROSITEi PS50848. START. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6."
    Soccio R.E., Adams R.M., Romanowski M.J., Sehayek E., Burley S.K., Breslow J.L.
    Proc. Natl. Acad. Sci. U.S.A. 99:6943-6948(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-213 (ISOFORM 1).
    Tissue: Small intestine.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas.
  5. Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 6-213.

Entry informationi

Entry nameiSTAR5_HUMAN
AccessioniPrimary (citable) accession number: Q9NSY2
Secondary accession number(s): P59094
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: November 26, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3