Q9NSY2 (STAR5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: StAR-related lipid transfer protein 5 Alternative name(s): START domain-containing protein 5 Short name=StARD5 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 213 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols By similarity. |
| Sequence similarities | Contains 1 START domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid transport Transport |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Lipid-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | C21-steroid hormone biosynthetic process Traceable author statement. Source: Reactome lipid transportInferred from electronic annotation. Source: UniProtKB-KW small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | lipid binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NSY2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NSY2-3) The sequence of this isoform differs from the canonical sequence as follows: 34-63: NGVSVSWRPSVEFPGNLYRGEGIVYGTLEE → VPRRRHCIWDTRGGVGLCEASCWRPTSEVG 64-213: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 213 | 213 | StAR-related lipid transfer protein 5 | PRO_0000220669 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 213 | 213 | START | |||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 34 – 63 | 30 | NGVSV…GTLEE → VPRRRHCIWDTRGGVGLCEA SCWRPTSEVG in isoform 2. | VSP_014871 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 64 – 213 | 150 | Missing in isoform 2. | VSP_014872 | ||||||||||||||||||||||||||||||||||||
| Natural variant | 74 | 1 | G → S. Corresponds to variant rs4384572 [ dbSNP | Ensembl ]. | VAR_052071 | ||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Helix | 6 – 22 | 17 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 28 – 31 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 42 | 9 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 59 | 16 | ||||||||||||||||||||||||||||||||||||||
| Helix | 61 – 68 | 8 | ||||||||||||||||||||||||||||||||||||||
| Helix | 76 – 79 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 84 – 91 | 8 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 102 | 10 | ||||||||||||||||||||||||||||||||||||||
| Turn | 107 – 110 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 114 – 124 | 11 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 136 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 153 | 5 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 155 – 162 | 8 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 170 – 176 | 7 | ||||||||||||||||||||||||||||||||||||||
| Helix | 186 – 209 | 24 | ||||||||||||||||||||||||||||||||||||||
| Helix | 210 – 212 | 3 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF480304 mRNA. Translation: AAL89654.1. AL137657 mRNA. Translation: CAB70862.2. AK026352 mRNA. No translation available. BC004365 mRNA. Translation: AAH04365.2. | ||||||||||||
| IPI | IPI00164831. IPI00394786. | ||||||||||||
| PIR | T46357. | ||||||||||||
| RefSeq | NP_871629.1. NM_181900.2. | ||||||||||||
| UniGene | Hs.513075. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NSY2. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000304032. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 25091329. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9NSY2. | ||||||||||||
| PRIDE | Q9NSY2. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 80765. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000302824; ENSP00000304032; ENSG00000172345. ENST00000325346; ENSP00000317519; ENSG00000172345. | ||||||||||||
| GeneID | 80765. | ||||||||||||
| KEGG | hsa:80765. | ||||||||||||
| UCSC | uc002bgm.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 80765. | ||||||||||||
| GeneCards | GC15M081601. | ||||||||||||
| HGNC | HGNC:18065. STARD5. | ||||||||||||
| HPA | HPA040662. HPA040682. | ||||||||||||
| MIM | 607050. gene. | ||||||||||||
| neXtProt | NX_Q9NSY2. | ||||||||||||
| PharmGKB | PA38286. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG255993. | ||||||||||||
| HOGENOM | HOG000137345. | ||||||||||||
| HOVERGEN | HBG055194. | ||||||||||||
| InParanoid | Q9NSY2. | ||||||||||||
| OMA | CFCEPVP. | ||||||||||||
| OrthoDB | EOG43TZWF. | ||||||||||||
| PhylomeDB | Q9NSY2. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_15493. Steroid hormones. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NSY2. | ||||||||||||
| Bgee | Q9NSY2. | ||||||||||||
| CleanEx | HS_STARD5. | ||||||||||||
| Genevestigator | Q9NSY2. | ||||||||||||
| GermOnline | ENSG00000172345. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.530.20. 1 hit. | ||||||||||||
| InterPro | IPR023393. START-like_dom. IPR002913. START_lipid-bd_dom. [Graphical view] | ||||||||||||
| Pfam | PF01852. START. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00234. START. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50848. START. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9NSY2. | ||||||||||||
| GenomeRNAi | 80765. | ||||||||||||
| NextBio | 71151. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | STAR5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NSY2 Secondary accession number(s): P59094 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
