Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NSY2 (STAR5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 99. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
StAR-related lipid transfer protein 5
Alternative name(s):
START domain-containing protein 5
Short name=StARD5
Gene names
Name:STARD5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length213 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols By similarity.

Sequence similarities

Contains 1 START domain.

Ontologies

Keywords
   Biological processLipid transport
Transport
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandLipid-binding
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processC21-steroid hormone biosynthetic process

Traceable author statement. Source: Reactome

lipid transport

Inferred from electronic annotation. Source: UniProtKB-KW

small molecule metabolic process

Traceable author statement. Source: Reactome

steroid metabolic process

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

   Molecular_functionlipid binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NSY2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NSY2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     34-63: NGVSVSWRPSVEFPGNLYRGEGIVYGTLEE → VPRRRHCIWDTRGGVGLCEASCWRPTSEVG
     64-213: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 213213StAR-related lipid transfer protein 5
PRO_0000220669

Regions

Domain1 – 213213START

Natural variations

Alternative sequence34 – 6330NGVSV…GTLEE → VPRRRHCIWDTRGGVGLCEA SCWRPTSEVG in isoform 2.
VSP_014871
Alternative sequence64 – 213150Missing in isoform 2.
VSP_014872
Natural variant741G → S.
Corresponds to variant rs4384572 [ dbSNP | Ensembl ].
VAR_052071

Secondary structure

................................ 213
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 15, 2002. Version 2.
Checksum: EE5547A7846AB3C4

FASTA21323,794
        10         20         30         40         50         60 
MDPALAAQMS EAVAEKMLQY RRDTAGWKIC REGNGVSVSW RPSVEFPGNL YRGEGIVYGT 

        70         80         90        100        110        120 
LEEVWDCVKP AVGGLRVKWD ENVTGFEIIQ SITDTLCVSR TSTPSAAMKL ISPRDFVDLV 

       130        140        150        160        170        180 
LVKRYEDGTI SSNATHVEHP LCPPKPGFVR GFNHPCGCFC EPLPGEPTKT NLVTFFHTDL 

       190        200        210 
SGYLPQNVVD SFFPRSMTRF YANLQKAVKQ FHE 

« Hide

Isoform 2 [UniParc].

Checksum: 1D457C21C9A0FDE1
Show »

FASTA637,094

References

« Hide 'large scale' references
[1]"The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6."
Soccio R.E., Adams R.M., Romanowski M.J., Sehayek E., Burley S.K., Breslow J.L.
Proc. Natl. Acad. Sci. U.S.A. 99:6943-6948(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Liver.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-213 (ISOFORM 1).
Tissue: Small intestine.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Pancreas.
[5]"Comparative structural analysis of lipid binding START domains."
Thorsell A.G., Lee W.H., Persson C., Siponen M.I., Nilsson M., Busam R.D., Kotenyova T., Schuler H., Lehtio L.
PLoS ONE 6:E19521-E19521(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 6-213.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF480304 mRNA. Translation: AAL89654.1.
AL137657 mRNA. Translation: CAB70862.2.
AK026352 mRNA. No translation available.
BC004365 mRNA. Translation: AAH04365.2.
PIRT46357.
RefSeqNP_871629.1. NM_181900.2.
UniGeneHs.513075.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2R55X-ray2.50A/B6-213[»]
ProteinModelPortalQ9NSY2.
SMRQ9NSY2. Positions 4-213.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000304032.

Polymorphism databases

DMDM25091329.

Proteomic databases

PaxDbQ9NSY2.
PRIDEQ9NSY2.

Protocols and materials databases

DNASU80765.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000302824; ENSP00000304032; ENSG00000172345. [Q9NSY2-1]
ENST00000325346; ENSP00000317519; ENSG00000172345. [Q9NSY2-3]
GeneID80765.
KEGGhsa:80765.
UCSCuc002bgm.3. human. [Q9NSY2-1]

Organism-specific databases

CTD80765.
GeneCardsGC15M081601.
HGNCHGNC:18065. STARD5.
HPAHPA040662.
HPA040682.
MIM607050. gene.
neXtProtNX_Q9NSY2.
PharmGKBPA38286.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG255993.
HOGENOMHOG000137345.
HOVERGENHBG055194.
InParanoidQ9NSY2.
OMACFCEPVP.
OrthoDBEOG7353XV.
PhylomeDBQ9NSY2.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_15493. Steroid hormones.

Gene expression databases

ArrayExpressQ9NSY2.
BgeeQ9NSY2.
CleanExHS_STARD5.
GenevestigatorQ9NSY2.

Family and domain databases

Gene3D3.30.530.20. 1 hit.
InterProIPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PfamPF01852. START. 1 hit.
[Graphical view]
SMARTSM00234. START. 1 hit.
[Graphical view]
PROSITEPS50848. START. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9NSY2.
GeneWikiSTARD5.
GenomeRNAi80765.
NextBio71151.
PROQ9NSY2.
SOURCESearch...

Entry information

Entry nameSTAR5_HUMAN
AccessionPrimary (citable) accession number: Q9NSY2
Secondary accession number(s): P59094
Entry history
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: April 16, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM