Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

StAR-related lipid transfer protein 5

Gene

STARD5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

ReactomeiREACT_11038. Pregnenolone biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
StAR-related lipid transfer protein 5
Alternative name(s):
START domain-containing protein 5
Short name:
StARD5
Gene namesi
Name:STARD5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:18065. STARD5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38286.

Polymorphism and mutation databases

BioMutaiSTARD5.
DMDMi25091329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 213213StAR-related lipid transfer protein 5PRO_0000220669Add
BLAST

Proteomic databases

PaxDbiQ9NSY2.
PRIDEiQ9NSY2.

Expressioni

Gene expression databases

BgeeiQ9NSY2.
CleanExiHS_STARD5.
ExpressionAtlasiQ9NSY2. baseline and differential.
GenevestigatoriQ9NSY2.

Organism-specific databases

HPAiHPA040662.
HPA040682.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000304032.

Structurei

Secondary structure

1
213
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi6 – 2217Combined sources
Beta strandi28 – 314Combined sources
Beta strandi34 – 429Combined sources
Beta strandi44 – 5916Combined sources
Helixi61 – 688Combined sources
Helixi76 – 794Combined sources
Beta strandi84 – 918Combined sources
Beta strandi93 – 10210Combined sources
Turni107 – 1104Combined sources
Beta strandi114 – 12411Combined sources
Beta strandi130 – 1367Combined sources
Beta strandi149 – 1535Combined sources
Beta strandi155 – 1628Combined sources
Beta strandi170 – 1767Combined sources
Helixi186 – 20924Combined sources
Helixi210 – 2123Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2R55X-ray2.50A/B6-213[»]
ProteinModelPortaliQ9NSY2.
SMRiQ9NSY2. Positions 4-213.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NSY2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 213213STARTPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 START domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG255993.
GeneTreeiENSGT00530000063294.
HOGENOMiHOG000137345.
HOVERGENiHBG055194.
InParanoidiQ9NSY2.
OMAiWRPSTEF.
OrthoDBiEOG7353XV.
PhylomeDBiQ9NSY2.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR029868. StARD5.
IPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PANTHERiPTHR12136:SF44. PTHR12136:SF44. 1 hit.
PfamiPF01852. START. 1 hit.
[Graphical view]
SMARTiSM00234. START. 1 hit.
[Graphical view]
PROSITEiPS50848. START. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NSY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDPALAAQMS EAVAEKMLQY RRDTAGWKIC REGNGVSVSW RPSVEFPGNL
60 70 80 90 100
YRGEGIVYGT LEEVWDCVKP AVGGLRVKWD ENVTGFEIIQ SITDTLCVSR
110 120 130 140 150
TSTPSAAMKL ISPRDFVDLV LVKRYEDGTI SSNATHVEHP LCPPKPGFVR
160 170 180 190 200
GFNHPCGCFC EPLPGEPTKT NLVTFFHTDL SGYLPQNVVD SFFPRSMTRF
210
YANLQKAVKQ FHE
Length:213
Mass (Da):23,794
Last modified:November 15, 2002 - v2
Checksum:iEE5547A7846AB3C4
GO
Isoform 2 (identifier: Q9NSY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-63: NGVSVSWRPSVEFPGNLYRGEGIVYGTLEE → VPRRRHCIWDTRGGVGLCEASCWRPTSEVG
     64-213: Missing.

Note: No experimental confirmation available.

Show »
Length:63
Mass (Da):7,094
Checksum:i1D457C21C9A0FDE1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti74 – 741G → S.
Corresponds to variant rs4384572 [ dbSNP | Ensembl ].
VAR_052071

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei34 – 6330NGVSV…GTLEE → VPRRRHCIWDTRGGVGLCEA SCWRPTSEVG in isoform 2. 1 PublicationVSP_014871Add
BLAST
Alternative sequencei64 – 213150Missing in isoform 2. 1 PublicationVSP_014872Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF480304 mRNA. Translation: AAL89654.1.
AL137657 mRNA. Translation: CAB70862.2.
AK026352 mRNA. No translation available.
BC004365 mRNA. Translation: AAH04365.2.
CCDSiCCDS10318.1. [Q9NSY2-1]
PIRiT46357.
RefSeqiNP_871629.1. NM_181900.2. [Q9NSY2-1]
UniGeneiHs.513075.

Genome annotation databases

EnsembliENST00000302824; ENSP00000304032; ENSG00000172345. [Q9NSY2-1]
ENST00000325346; ENSP00000317519; ENSG00000172345. [Q9NSY2-3]
GeneIDi80765.
KEGGihsa:80765.
UCSCiuc002bgm.3. human. [Q9NSY2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF480304 mRNA. Translation: AAL89654.1.
AL137657 mRNA. Translation: CAB70862.2.
AK026352 mRNA. No translation available.
BC004365 mRNA. Translation: AAH04365.2.
CCDSiCCDS10318.1. [Q9NSY2-1]
PIRiT46357.
RefSeqiNP_871629.1. NM_181900.2. [Q9NSY2-1]
UniGeneiHs.513075.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2R55X-ray2.50A/B6-213[»]
ProteinModelPortaliQ9NSY2.
SMRiQ9NSY2. Positions 4-213.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000304032.

Polymorphism and mutation databases

BioMutaiSTARD5.
DMDMi25091329.

Proteomic databases

PaxDbiQ9NSY2.
PRIDEiQ9NSY2.

Protocols and materials databases

DNASUi80765.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302824; ENSP00000304032; ENSG00000172345. [Q9NSY2-1]
ENST00000325346; ENSP00000317519; ENSG00000172345. [Q9NSY2-3]
GeneIDi80765.
KEGGihsa:80765.
UCSCiuc002bgm.3. human. [Q9NSY2-1]

Organism-specific databases

CTDi80765.
GeneCardsiGC15M081601.
HGNCiHGNC:18065. STARD5.
HPAiHPA040662.
HPA040682.
MIMi607050. gene.
neXtProtiNX_Q9NSY2.
PharmGKBiPA38286.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG255993.
GeneTreeiENSGT00530000063294.
HOGENOMiHOG000137345.
HOVERGENiHBG055194.
InParanoidiQ9NSY2.
OMAiWRPSTEF.
OrthoDBiEOG7353XV.
PhylomeDBiQ9NSY2.

Enzyme and pathway databases

ReactomeiREACT_11038. Pregnenolone biosynthesis.

Miscellaneous databases

EvolutionaryTraceiQ9NSY2.
GeneWikiiSTARD5.
GenomeRNAii80765.
NextBioi71151.
PROiQ9NSY2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NSY2.
CleanExiHS_STARD5.
ExpressionAtlasiQ9NSY2. baseline and differential.
GenevestigatoriQ9NSY2.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR029868. StARD5.
IPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PANTHERiPTHR12136:SF44. PTHR12136:SF44. 1 hit.
PfamiPF01852. START. 1 hit.
[Graphical view]
SMARTiSM00234. START. 1 hit.
[Graphical view]
PROSITEiPS50848. START. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6."
    Soccio R.E., Adams R.M., Romanowski M.J., Sehayek E., Burley S.K., Breslow J.L.
    Proc. Natl. Acad. Sci. U.S.A. 99:6943-6948(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-213 (ISOFORM 1).
    Tissue: Small intestine.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas.
  5. Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 6-213.

Entry informationi

Entry nameiSTAR5_HUMAN
AccessioniPrimary (citable) accession number: Q9NSY2
Secondary accession number(s): P59094
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: April 29, 2015
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.