Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NSY2

- STAR5_HUMAN

UniProt

Q9NSY2 - STAR5_HUMAN

Protein

StAR-related lipid transfer protein 5

Gene

STARD5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 2 (15 Nov 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols By similarity.By similarity

    GO - Molecular functioni

    1. lipid binding Source: UniProtKB-KW

    GO - Biological processi

    1. C21-steroid hormone biosynthetic process Source: Reactome
    2. lipid transport Source: UniProtKB-KW
    3. small molecule metabolic process Source: Reactome
    4. steroid metabolic process Source: Reactome

    Keywords - Biological processi

    Lipid transport, Transport

    Keywords - Ligandi

    Lipid-binding

    Enzyme and pathway databases

    ReactomeiREACT_11038. Pregnenolone biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    StAR-related lipid transfer protein 5
    Alternative name(s):
    START domain-containing protein 5
    Short name:
    StARD5
    Gene namesi
    Name:STARD5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:18065. STARD5.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38286.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 213213StAR-related lipid transfer protein 5PRO_0000220669Add
    BLAST

    Proteomic databases

    PaxDbiQ9NSY2.
    PRIDEiQ9NSY2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NSY2.
    BgeeiQ9NSY2.
    CleanExiHS_STARD5.
    GenevestigatoriQ9NSY2.

    Organism-specific databases

    HPAiHPA040662.
    HPA040682.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000304032.

    Structurei

    Secondary structure

    1
    213
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi6 – 2217
    Beta strandi28 – 314
    Beta strandi34 – 429
    Beta strandi44 – 5916
    Helixi61 – 688
    Helixi76 – 794
    Beta strandi84 – 918
    Beta strandi93 – 10210
    Turni107 – 1104
    Beta strandi114 – 12411
    Beta strandi130 – 1367
    Beta strandi149 – 1535
    Beta strandi155 – 1628
    Beta strandi170 – 1767
    Helixi186 – 20924
    Helixi210 – 2123

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2R55X-ray2.50A/B6-213[»]
    ProteinModelPortaliQ9NSY2.
    SMRiQ9NSY2. Positions 4-213.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9NSY2.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 213213STARTPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 START domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG255993.
    HOGENOMiHOG000137345.
    HOVERGENiHBG055194.
    InParanoidiQ9NSY2.
    OMAiCFCEPVP.
    OrthoDBiEOG7353XV.
    PhylomeDBiQ9NSY2.

    Family and domain databases

    Gene3Di3.30.530.20. 1 hit.
    InterProiIPR023393. START-like_dom.
    IPR002913. START_lipid-bd_dom.
    [Graphical view]
    PfamiPF01852. START. 1 hit.
    [Graphical view]
    SMARTiSM00234. START. 1 hit.
    [Graphical view]
    PROSITEiPS50848. START. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NSY2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDPALAAQMS EAVAEKMLQY RRDTAGWKIC REGNGVSVSW RPSVEFPGNL    50
    YRGEGIVYGT LEEVWDCVKP AVGGLRVKWD ENVTGFEIIQ SITDTLCVSR 100
    TSTPSAAMKL ISPRDFVDLV LVKRYEDGTI SSNATHVEHP LCPPKPGFVR 150
    GFNHPCGCFC EPLPGEPTKT NLVTFFHTDL SGYLPQNVVD SFFPRSMTRF 200
    YANLQKAVKQ FHE 213
    Length:213
    Mass (Da):23,794
    Last modified:November 15, 2002 - v2
    Checksum:iEE5547A7846AB3C4
    GO
    Isoform 2 (identifier: Q9NSY2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         34-63: NGVSVSWRPSVEFPGNLYRGEGIVYGTLEE → VPRRRHCIWDTRGGVGLCEASCWRPTSEVG
         64-213: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:63
    Mass (Da):7,094
    Checksum:i1D457C21C9A0FDE1
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti74 – 741G → S.
    Corresponds to variant rs4384572 [ dbSNP | Ensembl ].
    VAR_052071

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei34 – 6330NGVSV…GTLEE → VPRRRHCIWDTRGGVGLCEA SCWRPTSEVG in isoform 2. 1 PublicationVSP_014871Add
    BLAST
    Alternative sequencei64 – 213150Missing in isoform 2. 1 PublicationVSP_014872Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF480304 mRNA. Translation: AAL89654.1.
    AL137657 mRNA. Translation: CAB70862.2.
    AK026352 mRNA. No translation available.
    BC004365 mRNA. Translation: AAH04365.2.
    CCDSiCCDS10318.1. [Q9NSY2-1]
    PIRiT46357.
    RefSeqiNP_871629.1. NM_181900.2. [Q9NSY2-1]
    UniGeneiHs.513075.

    Genome annotation databases

    EnsembliENST00000302824; ENSP00000304032; ENSG00000172345. [Q9NSY2-1]
    ENST00000325346; ENSP00000317519; ENSG00000172345. [Q9NSY2-3]
    GeneIDi80765.
    KEGGihsa:80765.
    UCSCiuc002bgm.3. human. [Q9NSY2-1]

    Polymorphism databases

    DMDMi25091329.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF480304 mRNA. Translation: AAL89654.1 .
    AL137657 mRNA. Translation: CAB70862.2 .
    AK026352 mRNA. No translation available.
    BC004365 mRNA. Translation: AAH04365.2 .
    CCDSi CCDS10318.1. [Q9NSY2-1 ]
    PIRi T46357.
    RefSeqi NP_871629.1. NM_181900.2. [Q9NSY2-1 ]
    UniGenei Hs.513075.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2R55 X-ray 2.50 A/B 6-213 [» ]
    ProteinModelPortali Q9NSY2.
    SMRi Q9NSY2. Positions 4-213.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000304032.

    Polymorphism databases

    DMDMi 25091329.

    Proteomic databases

    PaxDbi Q9NSY2.
    PRIDEi Q9NSY2.

    Protocols and materials databases

    DNASUi 80765.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000302824 ; ENSP00000304032 ; ENSG00000172345 . [Q9NSY2-1 ]
    ENST00000325346 ; ENSP00000317519 ; ENSG00000172345 . [Q9NSY2-3 ]
    GeneIDi 80765.
    KEGGi hsa:80765.
    UCSCi uc002bgm.3. human. [Q9NSY2-1 ]

    Organism-specific databases

    CTDi 80765.
    GeneCardsi GC15M081601.
    HGNCi HGNC:18065. STARD5.
    HPAi HPA040662.
    HPA040682.
    MIMi 607050. gene.
    neXtProti NX_Q9NSY2.
    PharmGKBi PA38286.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG255993.
    HOGENOMi HOG000137345.
    HOVERGENi HBG055194.
    InParanoidi Q9NSY2.
    OMAi CFCEPVP.
    OrthoDBi EOG7353XV.
    PhylomeDBi Q9NSY2.

    Enzyme and pathway databases

    Reactomei REACT_11038. Pregnenolone biosynthesis.

    Miscellaneous databases

    EvolutionaryTracei Q9NSY2.
    GeneWikii STARD5.
    GenomeRNAii 80765.
    NextBioi 71151.
    PROi Q9NSY2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NSY2.
    Bgeei Q9NSY2.
    CleanExi HS_STARD5.
    Genevestigatori Q9NSY2.

    Family and domain databases

    Gene3Di 3.30.530.20. 1 hit.
    InterProi IPR023393. START-like_dom.
    IPR002913. START_lipid-bd_dom.
    [Graphical view ]
    Pfami PF01852. START. 1 hit.
    [Graphical view ]
    SMARTi SM00234. START. 1 hit.
    [Graphical view ]
    PROSITEi PS50848. START. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6."
      Soccio R.E., Adams R.M., Romanowski M.J., Sehayek E., Burley S.K., Breslow J.L.
      Proc. Natl. Acad. Sci. U.S.A. 99:6943-6948(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 51-213 (ISOFORM 1).
      Tissue: Small intestine.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pancreas.
    5. Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 6-213.

    Entry informationi

    Entry nameiSTAR5_HUMAN
    AccessioniPrimary (citable) accession number: Q9NSY2
    Secondary accession number(s): P59094
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 15, 2002
    Last sequence update: November 15, 2002
    Last modified: October 1, 2014
    This is version 103 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3