Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein C19orf12

Gene

C19orf12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein C19orf12
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:25443. C19orf12.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei51 – 7121HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB
  2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  3. integral component of membrane Source: UniProtKB-KW
  4. mitochondrial membrane Source: UniProtKB-SubCell
  5. mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

Pathology & Biotechi

Involvement in diseasei

Neurodegeneration with brain iron accumulation 46 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. NBIA4 results in speech difficulty, extrapyramidal signs, oromandibular and generalized dystonia, and parkinsonism. Most patients have progressive involvement of the corticospinal tract, with spasticity, hyperreflexia, and extensor plantar responses.

See also OMIM:614298
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti11 – 111T → M in NBIA4. 1 Publication
VAR_066617
Natural varianti39 – 391S → F in NBIA4. 1 Publication
VAR_069756
Natural varianti48 – 481A → P in NBIA4. 1 Publication
VAR_069757
Natural varianti53 – 531G → R in NBIA4. 2 Publications
Corresponds to variant rs200133991 [ dbSNP | Ensembl ].
VAR_066618
Natural varianti60 – 601P → L in NBIA4. 1 Publication
VAR_069758
Natural varianti63 – 631A → P in NBIA4 and SPG43; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 1 Publication
VAR_070668
Natural varianti65 – 651G → E in NBIA4. 2 Publications
VAR_066619
Natural varianti65 – 651G → V in NBIA4. 1 Publication
VAR_069759
Natural varianti66 – 661Missing in NBIA4; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 2 Publications
VAR_070669
Natural varianti69 – 691G → R in NBIA4; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 3 Publications
VAR_066620
Natural varianti83 – 831P → L in NBIA4. 1 Publication
Corresponds to variant rs201987973 [ dbSNP | Ensembl ].
VAR_069760
Natural varianti98 – 981R → S in NBIA4. 1 Publication
VAR_069761
Natural varianti121 – 1211L → Q in NBIA4. 1 Publication
VAR_069762
Natural varianti134 – 1341A → P in NBIA4; unknown pathological significance. 1 Publication
VAR_069763
Spastic paraplegia 43, autosomal recessive1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. SP43 is characterized by childhood onset of progressive spasticity affecting the lower and upper limbs.

See also OMIM:615043
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti63 – 631A → P in NBIA4 and SPG43; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 1 Publication
VAR_070668

Keywords - Diseasei

Disease mutation, Hereditary spastic paraplegia, Neurodegeneration

Organism-specific databases

MIMi614298. phenotype.
615043. phenotype.
Orphaneti320370. Autosomal recessive spastic paraplegia type 43.
289560. Neurodegeneration with brain iron accumulation due to C19orf12 mutation.
PharmGKBiPA134981038.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 152152Protein C19orf12PRO_0000296662Add
BLAST

Proteomic databases

MaxQBiQ9NSK7.
PaxDbiQ9NSK7.
PRIDEiQ9NSK7.

PTM databases

PhosphoSiteiQ9NSK7.

Expressioni

Inductioni

Up-regulated during adipocyte differentiation in an in vitro preadipocyte differentiation model.1 Publication

Gene expression databases

BgeeiQ9NSK7.
CleanExiHS_C19orf12.
ExpressionAtlasiQ9NSK7. baseline and differential.
GenevestigatoriQ9NSK7.

Organism-specific databases

HPAiHPA046930.

Interactioni

Protein-protein interaction databases

BioGridi123700. 2 interactions.
IntActiQ9NSK7. 2 interactions.
STRINGi9606.ENSP00000376103.

Structurei

3D structure databases

ProteinModelPortaliQ9NSK7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG69864.
GeneTreeiENSGT00390000009077.
HOGENOMiHOG000007731.
HOVERGENiHBG054390.
InParanoidiQ9NSK7.
OMAiMPIDTRE.
OrthoDBiEOG779P1P.
PhylomeDBiQ9NSK7.
TreeFamiTF323308.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 4 (identifier: Q9NSK7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MERLKSHKPA TMTIMVEDIM KLLCSLSGER KMKAAVKHSG KGALVTGAMA
60 70 80 90 100
FVGGLVGGPP GLAVGGAVGG LLGAWMTSGQ FKPVPQILME LPPAEQQRLF
110 120 130 140 150
NEAAAIIRHL EWTDAVQLTA LVMGSEALQQ QLLAMLVNYV TKELRAEIQY

DD
Length:152
Mass (Da):16,286
Last modified:January 25, 2012 - v3
Checksum:iF8C1300487F99BD5
GO
Isoform 2 (identifier: Q9NSK7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: Missing.

Show »
Length:77
Mass (Da):8,756
Checksum:iF720F9A34E03590C
GO
Isoform 3 (identifier: Q9NSK7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     109-152: HLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD → PCSSSCWPCW

Show »
Length:107
Mass (Da):11,113
Checksum:i6A96E70C52F2EC6F
GO
Isoform 1 (identifier: Q9NSK7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.

Show »
Length:141
Mass (Da):15,007
Checksum:iC6EEA8C17A909E7F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti11 – 111T → M in NBIA4. 1 Publication
VAR_066617
Natural varianti39 – 391S → F in NBIA4. 1 Publication
VAR_069756
Natural varianti48 – 481A → P in NBIA4. 1 Publication
VAR_069757
Natural varianti53 – 531G → R in NBIA4. 2 Publications
Corresponds to variant rs200133991 [ dbSNP | Ensembl ].
VAR_066618
Natural varianti60 – 601P → L in NBIA4. 1 Publication
VAR_069758
Natural varianti63 – 631A → P in NBIA4 and SPG43; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 1 Publication
VAR_070668
Natural varianti65 – 651G → E in NBIA4. 2 Publications
VAR_066619
Natural varianti65 – 651G → V in NBIA4. 1 Publication
VAR_069759
Natural varianti66 – 661Missing in NBIA4; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 2 Publications
VAR_070669
Natural varianti69 – 691G → R in NBIA4; impairs subcellular localization to the endoplasmic reticulum or mitochondrion. 3 Publications
VAR_066620
Natural varianti83 – 831P → L in NBIA4. 1 Publication
Corresponds to variant rs201987973 [ dbSNP | Ensembl ].
VAR_069760
Natural varianti98 – 981R → S in NBIA4. 1 Publication
VAR_069761
Natural varianti121 – 1211L → Q in NBIA4. 1 Publication
VAR_069762
Natural varianti134 – 1341A → P in NBIA4; unknown pathological significance. 1 Publication
VAR_069763
Natural varianti142 – 1421K → E Found in families with neurodegeneration with brain iron accumulation; uncertain pathological significance. 2 Publications
Corresponds to variant rs146170087 [ dbSNP | Ensembl ].
VAR_066621
Natural varianti142 – 1421K → T.2 Publications
Corresponds to variant rs79915936 [ dbSNP | Ensembl ].
VAR_066622
Natural varianti149 – 1491Q → R.1 Publication
Corresponds to variant rs73023451 [ dbSNP | Ensembl ].
VAR_069764

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7575Missing in isoform 2. 1 PublicationVSP_027227Add
BLAST
Alternative sequencei1 – 1111Missing in isoform 1 and isoform 3. 2 PublicationsVSP_037995Add
BLAST
Alternative sequencei109 – 15244HLEWT…IQYDD → PCSSSCWPCW in isoform 3. 1 PublicationVSP_027228Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057185 mRNA. Translation: BAG51878.1.
DA708831 mRNA. No translation available.
AC010513 Genomic DNA. No translation available.
BC004957 mRNA. Translation: AAH04957.1.
BC009946 mRNA. Translation: AAH09946.1.
BC063518 mRNA. Translation: AAH63518.1.
BC017211 mRNA. Translation: AAH17211.2.
AL162066 mRNA. Translation: CAB82403.1.
CCDSiCCDS12418.2. [Q9NSK7-4]
CCDS42542.1. [Q9NSK7-1]
CCDS59373.1. [Q9NSK7-3]
CCDS74325.1. [Q9NSK7-2]
PIRiT47169.
RefSeqiNP_001026896.2. NM_001031726.3. [Q9NSK7-1]
NP_001242975.1. NM_001256046.1. [Q9NSK7-3]
NP_001242976.1. NM_001256047.1. [Q9NSK7-4]
NP_001269858.1. NM_001282929.1. [Q9NSK7-2]
NP_001269859.1. NM_001282930.1. [Q9NSK7-2]
NP_001269860.1. NM_001282931.1. [Q9NSK7-2]
NP_113636.2. NM_031448.4. [Q9NSK7-4]
UniGeneiHs.529094.

Genome annotation databases

EnsembliENST00000323670; ENSP00000313332; ENSG00000131943. [Q9NSK7-4]
ENST00000392276; ENSP00000376102; ENSG00000131943. [Q9NSK7-2]
ENST00000392278; ENSP00000376103; ENSG00000131943. [Q9NSK7-1]
ENST00000592153; ENSP00000467117; ENSG00000131943. [Q9NSK7-3]
ENST00000614091; ENSP00000482097; ENSG00000131943. [Q9NSK7-4]
ENST00000623113; ENSP00000485413; ENSG00000131943. [Q9NSK7-2]
GeneIDi83636.
KEGGihsa:83636.
UCSCiuc002nsj.3. human. [Q9NSK7-1]
uc002nsm.4. human. [Q9NSK7-3]

Polymorphism databases

DMDMi374095505.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057185 mRNA. Translation: BAG51878.1.
DA708831 mRNA. No translation available.
AC010513 Genomic DNA. No translation available.
BC004957 mRNA. Translation: AAH04957.1.
BC009946 mRNA. Translation: AAH09946.1.
BC063518 mRNA. Translation: AAH63518.1.
BC017211 mRNA. Translation: AAH17211.2.
AL162066 mRNA. Translation: CAB82403.1.
CCDSiCCDS12418.2. [Q9NSK7-4]
CCDS42542.1. [Q9NSK7-1]
CCDS59373.1. [Q9NSK7-3]
CCDS74325.1. [Q9NSK7-2]
PIRiT47169.
RefSeqiNP_001026896.2. NM_001031726.3. [Q9NSK7-1]
NP_001242975.1. NM_001256046.1. [Q9NSK7-3]
NP_001242976.1. NM_001256047.1. [Q9NSK7-4]
NP_001269858.1. NM_001282929.1. [Q9NSK7-2]
NP_001269859.1. NM_001282930.1. [Q9NSK7-2]
NP_001269860.1. NM_001282931.1. [Q9NSK7-2]
NP_113636.2. NM_031448.4. [Q9NSK7-4]
UniGeneiHs.529094.

3D structure databases

ProteinModelPortaliQ9NSK7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123700. 2 interactions.
IntActiQ9NSK7. 2 interactions.
STRINGi9606.ENSP00000376103.

PTM databases

PhosphoSiteiQ9NSK7.

Polymorphism databases

DMDMi374095505.

Proteomic databases

MaxQBiQ9NSK7.
PaxDbiQ9NSK7.
PRIDEiQ9NSK7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000323670; ENSP00000313332; ENSG00000131943. [Q9NSK7-4]
ENST00000392276; ENSP00000376102; ENSG00000131943. [Q9NSK7-2]
ENST00000392278; ENSP00000376103; ENSG00000131943. [Q9NSK7-1]
ENST00000592153; ENSP00000467117; ENSG00000131943. [Q9NSK7-3]
ENST00000614091; ENSP00000482097; ENSG00000131943. [Q9NSK7-4]
ENST00000623113; ENSP00000485413; ENSG00000131943. [Q9NSK7-2]
GeneIDi83636.
KEGGihsa:83636.
UCSCiuc002nsj.3. human. [Q9NSK7-1]
uc002nsm.4. human. [Q9NSK7-3]

Organism-specific databases

CTDi83636.
GeneCardsiGC19M030189.
GeneReviewsiC19orf12.
H-InvDBHIX0014979.
HGNCiHGNC:25443. C19orf12.
HPAiHPA046930.
MIMi614297. gene.
614298. phenotype.
615043. phenotype.
neXtProtiNX_Q9NSK7.
Orphaneti320370. Autosomal recessive spastic paraplegia type 43.
289560. Neurodegeneration with brain iron accumulation due to C19orf12 mutation.
PharmGKBiPA134981038.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG69864.
GeneTreeiENSGT00390000009077.
HOGENOMiHOG000007731.
HOVERGENiHBG054390.
InParanoidiQ9NSK7.
OMAiMPIDTRE.
OrthoDBiEOG779P1P.
PhylomeDBiQ9NSK7.
TreeFamiTF323308.

Miscellaneous databases

GenomeRNAii83636.
NextBioi72567.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NSK7.
CleanExiHS_C19orf12.
ExpressionAtlasiQ9NSK7. baseline and differential.
GenevestigatoriQ9NSK7.

Family and domain databases

ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-144 (ISOFORM 4).
    Tissue: Stomach and Teratocarcinoma.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 72-152 (ISOFORMS 1/4).
    Tissue: Brain, Lymph and Ovary.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-141 (ISOFORMS 1/2).
    Tissue: Melanoma.
  5. "A novel frameshift mutation of C19ORF12 causes NBIA4 with cerebellar atrophy and manifests with severe peripheral motor axonal neuropathy."
    Schottmann G., Stenzel W., Lutzkendorf S., Schuelke M., Knierim E.
    Clin. Genet. 85:290-292(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN NBIA4.
  6. Cited for: VARIANTS NBIA4 MET-11; ARG-53; GLU-65 AND ARG-69, VARIANTS GLU-142 AND THR-142, SUBCELLULAR LOCATION, INDUCTION.
  7. "C19orf12 mutations in neurodegeneration with brain iron accumulation mimicking juvenile amyotrophic lateral sclerosis."
    Deschauer M., Gaul C., Behrmann C., Prokisch H., Zierz S., Haack T.B.
    J. Neurol. 259:2434-2439(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT NBIA4 GLY-66 DEL.
  8. Cited for: VARIANT NBIA4 GLN-121.
  9. Cited for: VARIANTS NBIA4 PHE-39; PRO-48; ARG-53; LEU-60; GLU-65; VAL-65; ARG-69; LEU-83; SER-98 AND PRO-134, VARIANTS GLU-142; THR-142 AND ARG-149.
  10. Cited for: VARIANT SPG43 PRO-63, VARIANTS NBIA4 PRO-63 AND GLY-66 DEL, SUBCELLULAR LOCATION, CHARACTERIZATION OF VARIANTS SPG43 PRO-63, CHARACTERIZATION OF VARIANTS NBIA4 PRO-63; GLY-66 DEL AND ARG-69.

Entry informationi

Entry nameiCS012_HUMAN
AccessioniPrimary (citable) accession number: Q9NSK7
Secondary accession number(s): B3KQ16
, Q0D2Q0, Q6P4C5, Q9BSL7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: January 25, 2012
Last modified: February 4, 2015
This is version 81 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.