Q9NSE7 (ABCCD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative ATP-binding cassette sub-family C member 13 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 274 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Highest expression in fetal liver and fetal spleen. In the adult, highest levels are found in the colon ascending and transverse. Also expressed in brain, placenta, lung, liver, pancreas and ovary. In bone marrow cells, levels are several fold higher than in peripheral blood leukocytes. Ref.1 Ref.2 Ref.5 |
| Induction | Down-regulated by cell differentiation in certain leukemia cells. Ref.1 |
| Sequence similarities | Belongs to the binding-protein-dependent transport system permease family. Contains 1 ABC transmembrane type-1 domain. |
| Caution | Contains sequences related to the ABC transporters of subfamily C, but lacks Walker A, Walker B, and signature C motifs, indicating that it is a nonfunctional ABC transporter. Translation of the cDNA in a different reading frame predicts a 93 amino acid peptide with signature C and Walker B motifs, but no Walker A motif. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW nucleusNon-traceable author statement. Source: UniProtKB |
| Molecular function | ATP binding Inferred from electronic annotation. Source: InterPro ATPase activity, coupled to transmembrane movement of substancesInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9NSE7-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NSE7-2) The sequence of this isoform differs from the canonical sequence as follows: 200-274: ALLLSNVSRQ...CYTNKCFSCN → VSLATLCVYF...CKKTFSLAPS | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q9NSE7-3) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 141-274: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q9NSE7-4) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 140-169: KQIIIFCEHSSDFGWNGYGYAVALLVVVFL → NYTRKVNYLMGLPCENQKITSYSQASGRDS 170-274: Missing. | ||||||
| Isoform 5 (identifier: Q9NSE7-5) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 10-42: GSYQRVRGALDTQKCSPEKSASFFSKVTYSWFS → RLIH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 274 | 274 | Putative ATP-binding cassette sub-family C member 13 | PRO_0000093475 | |||||
Regions | |||||||||
| Transmembrane | 118 – 138 | 21 | Helical; Potential | ||||||
| Transmembrane | 154 – 174 | 21 | Helical; Potential | ||||||
| Domain | 118 – 274 | 157 | ABC transmembrane type-1 | ||||||
Natural variations | |||||||||
| Alternative sequence | 10 – 42 | 33 | GSYQR…YSWFS → RLIH in isoform 5. | VSP_012454 | |||||
| Alternative sequence | 140 – 169 | 30 | KQIII…VVVFL → NYTRKVNYLMGLPCENQKIT SYSQASGRDS in isoform 4. | VSP_012455 | |||||
| Alternative sequence | 141 – 274 | 134 | Missing in isoform 3. | VSP_000067 | |||||
| Alternative sequence | 170 – 274 | 105 | Missing in isoform 4. | VSP_012456 | |||||
| Alternative sequence | 200 – 274 | 75 | ALLLS…CFSCN → VSLATLCVYFLLDEGNILTA TKVFTSMSLFNILRIPLFEL PTVISAVVQTKISLGRLEDF LNTEELLPQSIETNYTGDHA IGFTDASFSWDKTGMPVLKE ALWLMFLSRPGFRIAFCKKT FSLAPS in isoform 2. | VSP_000066 | |||||
| Natural variant | 228 | 1 | S → N. Corresponds to variant rs2822558 [ dbSNP | Ensembl ]. | VAR_020247 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ABCC13, an unusual truncated ABC transporter, is highly expressed in fetal human liver." Yabuuchi H., Takayanagi S., Yoshinaga K., Taniguchi N., Aburatani H., Ishikawa T. Biochem. Biophys. Res. Commun. 299:410-417(2002) [PubMed: 12445816] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), INDUCTION, TISSUE SPECIFICITY. Tissue: Liver and Placenta. |
| [2] | "Degeneration of an ATP-binding cassette transporter gene, ABCC13, in different mammalian lineages." Annilo T., Dean M. Genomics 84:34-46(2004) [PubMed: 15203202] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY. |
| [3] | "Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms." Brun M.-E., Ruault M., Ventura M., Roizes G., De Sario A. Gene 312:41-50(2003) [PubMed: 12909339] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5). |
| [4] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis." Gardiner K., Slavov D., Bechtel L., Davisson M. Genomics 79:833-843(2002) [PubMed: 12036298] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [6] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY063514 mRNA. Translation: AAL47201.1. AF418600 mRNA. Translation: AAL99903.1. AY063515 mRNA. Translation: AAL47202.1. AY344117 mRNA. Translation: AAQ22368.1. AF518320 mRNA. Translation: AAM70494.1. AF518321 mRNA. Translation: AAM70495.1. AP001660 Genomic DNA. Translation: BAA95546.1. |
| IPI | IPI00025740. IPI00172522. IPI00216009. IPI00216010. IPI00220831. |
| PIR | JC7909. |
| UniGene | Hs.366575. |
3D structure databases | |
| ProteinModelPortal | Q9NSE7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9NSE7. |
PTM databases | |
| PhosphoSite | Q9NSE7. |
Polymorphism databases | |
| DMDM | 21541961. |
Proteomic databases | |
| PRIDE | Q9NSE7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| UCSC | uc002yjq.1. human. uc002yjr.1. human. |
Organism-specific databases | |
| GeneCards | GC21P015647. |
| HGNC | HGNC:16022. ABCC13. |
| MIM | 608835. gene. |
| neXtProt | NX_Q9NSE7. |
| GenAtlas | Search... |
Phylogenomic databases | |
| OMA | FRIAFCK. |
Gene expression databases | |
| ArrayExpress | Q9NSE7. |
| CleanEx | HS_ABCC13. |
| Genevestigator | Q9NSE7. |
| GermOnline | ENSG00000155288. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017940. ABC_transporter_type1. IPR001140. ABC_transptr_TM_dom. IPR011527. ABC_transptrTM_dom_typ1. [Graphical view] |
| Pfam | PF00664. ABC_membrane. 1 hit. [Graphical view] |
| SUPFAM | SSF90123. ABC_TM_1. 1 hit. |
| PROSITE | PS50929. ABC_TM1F. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | ABCCD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NSE7 Secondary accession number(s): Q8N6A4, Q8N6A5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with