Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative ATP-binding cassette sub-family C member 13

Gene

ABCC13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Caution

Contains sequences related to the ABC transporters of subfamily C, but lacks Walker A, Walker B, and signature C motifs, indicating that it is a nonfunctional ABC transporter. Translation of the cDNA in a different reading frame predicts a 93 amino acid peptide with signature C and Walker B motifs, but no Walker A motif.Curated

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Putative ATP-binding cassette sub-family C member 13
Gene namesi
Name:ABCC13
Synonyms:C21orf73, PRED6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:16022 ABCC13
MIMi608835 gene
neXtProtiNX_Q9NSE7

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei118 – 138HelicalPROSITE-ProRule annotationAdd BLAST21
Transmembranei154 – 174HelicalPROSITE-ProRule annotationAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi150000

Polymorphism and mutation databases

DMDMi21541961

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000934751 – 274Putative ATP-binding cassette sub-family C member 13Add BLAST274

Proteomic databases

PRIDEiQ9NSE7

PTM databases

iPTMnetiQ9NSE7
PhosphoSitePlusiQ9NSE7

Expressioni

Tissue specificityi

Highest expression in fetal liver and fetal spleen. In the adult, highest levels are found in the colon ascending and transverse. Also expressed in brain, placenta, lung, liver, pancreas and ovary. In bone marrow cells, levels are several fold higher than in peripheral blood leukocytes.3 Publications

Inductioni

Down-regulated by cell differentiation in certain leukemia cells.1 Publication

Gene expression databases

CleanExiHS_ABCC13

Structurei

3D structure databases

ProteinModelPortaliQ9NSE7
SMRiQ9NSE7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini118 – 274ABC transmembrane type-1PROSITE-ProRule annotationAdd BLAST157

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

InParanoidiQ9NSE7
PhylomeDBiQ9NSE7

Family and domain databases

InterProiView protein in InterPro
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
PfamiView protein in Pfam
PF00664 ABC_membrane, 1 hit
SUPFAMiSSF90123 SSF90123, 1 hit
PROSITEiView protein in PROSITE
PS50929 ABC_TM1F, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9NSE7-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSSTQNAGG SYQRVRGALD TQKCSPEKSA SFFSKVTYSW FSRVITLGYK
60 70 80 90 100
RPLEREDLFE LKESDSFCTA CPIFEKQWRK EVLRNQERQK VKVSCYKEAH
110 120 130 140 150
IKKPSLLYAL WNTFKSILIQ VALFKVFADI LSFTSPLIMK QIIIFCEHSS
160 170 180 190 200
DFGWNGYGYA VALLVVVFLQ TLILQQYQRF NMLTSAKVKT AVNGLIYKKA
210 220 230 240 250
LLLSNVSRQK FSTGEIINLM SATHGLDSKP QSPLVCPFSN PNGRISPLAR
260 270
AGSSSVSRGG SPCVCYTNKC FSCN
Length:274
Mass (Da):30,831
Last modified:June 20, 2002 - v2
Checksum:i02BFDCFE0F6D623F
GO
Isoform 2 (identifier: Q9NSE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-274: ALLLSNVSRQ...CYTNKCFSCN → VSLATLCVYF...CKKTFSLAPS

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:325
Mass (Da):37,042
Checksum:iB29D83108B52FB61
GO
Isoform 3 (identifier: Q9NSE7-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     141-274: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:140
Mass (Da):16,263
Checksum:i380A5ACD4854A143
GO
Isoform 4 (identifier: Q9NSE7-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     140-169: KQIIIFCEHSSDFGWNGYGYAVALLVVVFL → NYTRKVNYLMGLPCENQKITSYSQASGRDS
     170-274: Missing.

Show »
Length:169
Mass (Da):19,542
Checksum:i0A05B2E6D0E914EF
GO
Isoform 5 (identifier: Q9NSE7-5) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     10-42: GSYQRVRGALDTQKCSPEKSASFFSKVTYSWFS → RLIH

Show »
Length:245
Mass (Da):27,619
Checksum:iAE97FFB60A3CF605
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020247228S → N. Corresponds to variant dbSNP:rs2822558Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01245410 – 42GSYQR…YSWFS → RLIH in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_012455140 – 169KQIII…VVVFL → NYTRKVNYLMGLPCENQKIT SYSQASGRDS in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_000067141 – 274Missing in isoform 3. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_012456170 – 274Missing in isoform 4. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_000066200 – 274ALLLS…CFSCN → VSLATLCVYFLLDEGNILTA TKVFTSMSLFNILRIPLFEL PTVISAVVQTKISLGRLEDF LNTEELLPQSIETNYTGDHA IGFTDASFSWDKTGMPVLKE ALWLMFLSRPGFRIAFCKKT FSLAPS in isoform 2. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY063514 mRNA Translation: AAL47201.1
AF418600 mRNA Translation: AAL99903.1
AY063515 mRNA Translation: AAL47202.1
AY344117 mRNA Translation: AAQ22368.1
AF518320 mRNA Translation: AAM70494.1
AF518321 mRNA Translation: AAM70495.1
AP001660 Genomic DNA Translation: BAA95546.1
PIRiJC7909
UniGeneiHs.366575

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiABCCD_HUMAN
AccessioniPrimary (citable) accession number: Q9NSE7
Secondary accession number(s): Q8N6A4, Q8N6A5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2002
Last sequence update: June 20, 2002
Last modified: March 28, 2018
This is version 109 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health