Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NS73 (MBIP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
MAP3K12-binding inhibitory protein 1
Alternative name(s):
MAPK upstream kinase-binding inhibitory protein
Short name=MUK-binding inhibitory protein
Gene names
Name:MBIP
ORF Names:BM-015
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length344 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Ref.8

Subunit structure

Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. In the complex, it probably interacts directly with KAT2A, CSRP2BP and WDR5. Ref.8

Subcellular location

Nucleus. Cytoplasm. Note: Shows a cytoplasmic localization when coexpressed with MAP3K12.

Tissue specificity

Ubiquitous. High expression seen in the heart and lung.

Sequence caution

The sequence CAD62615.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NS73-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NS73-2)

The sequence of this isoform differs from the canonical sequence as follows:
     298-344: FSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP → L
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9NS73-3)

The sequence of this isoform differs from the canonical sequence as follows:
     264-344: GGPVPRDIYQ...AESMATHHLP → ELFWKKKKSSTTSTELFTG
Isoform 4 (identifier: Q9NS73-5)

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 344344MAP3K12-binding inhibitory protein 1
PRO_0000096269

Regions

Region172 – 344173Interaction with MAP3K12
Region271 – 28515Leucine-zipper 1 Potential
Region314 – 32916Leucine-zipper 2 Potential

Amino acid modifications

Modified residue911Phosphoserine Ref.6 Ref.7 Ref.9
Modified residue3011N6-acetyllysine By similarity

Natural variations

Alternative sequence264 – 34481GGPVP…THHLP → ELFWKKKKSSTTSTELFTG in isoform 3.
VSP_010265
Alternative sequence298 – 34447FSGKR…THHLP → L in isoform 2.
VSP_010266
Alternative sequence3091Missing in isoform 4.
VSP_040134
Natural variant71L → H. Ref.1 Ref.2 Ref.5
Corresponds to variant rs2899849 [ dbSNP | Ensembl ].
VAR_018449
Natural variant221R → S. Ref.1 Ref.2 Ref.5
Corresponds to variant rs3168891 [ dbSNP | Ensembl ].
VAR_034093

Experimental info

Sequence conflict2181N → Y in AAH05197. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: 9DABB35CA8695C02

FASTA34439,281
        10         20         30         40         50         60 
MAAATELNRP SSGDRNLERR CRPNLSREVL YEIFRSLHTL VGQLDLRDDV VKITIDWNKL 

        70         80         90        100        110        120 
QSLSAFQPAL LFSALEQHIL YLQPFLAKLQ SPIKEENTTA VEEIGRTEMG NKNEVNDKFS 

       130        140        150        160        170        180 
IGDLQEEEKH KESDLRDVKK TQIHFDPEVV QIKAGKAEID RRISAFIERK QAEINENNVR 

       190        200        210        220        230        240 
EFCNVIDCNQ ENSCARTDAI FTPYPGFKSH VKVSRVVNTY GPQTRPEGIP GSGHKPNSML 

       250        260        270        280        290        300 
RDCGNQAVEE RLQNIEAHLR LQTGGPVPRD IYQRIKKLED KILELEGISP EYFQSVSFSG 

       310        320        330        340 
KRRKVQPPQQ NYSLAELDEK ISALKQALLR KSREAESMAT HHLP 

« Hide

Isoform 2 [UniParc].

Checksum: 00856BC8902FA9B3
Show »

FASTA29834,023
Isoform 3 [UniParc].

Checksum: 4BD1C926F718E3B7
Show »

FASTA28232,223
Isoform 4 [UniParc].

Checksum: 97D44D5E8AB7DE60
Show »

FASTA34339,153

References

« Hide 'large scale' references
[1]"MAPK upstream kinase (MUK)-binding inhibitory protein, a negative regulator of MUK/Dual leucine zipper-bearing kinase/leucine zipper protein kinase."
Fukuyama K., Yoshida M., Yamashita A., Deyama T., Baba M., Suzuki A., Mohri H., Ikezawa Z., Nakajima H., Hirai S., Ohno S.
J. Biol. Chem. 275:21247-21254(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-7 AND SER-22.
Tissue: Kidney.
[2]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-7 AND SER-22.
Tissue: Bone marrow.
[3]"Full-length cDNA libraries and normalization."
Li W.B., Gruber C., Jessee J., Polayes D.
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Placenta.
[4]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS HIS-7 AND SER-22.
Tissue: Bone marrow and Urinary bladder.
[6]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
[9]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB038523 mRNA. Translation: BAA94083.1.
AF208857 mRNA. Translation: AAF64271.1.
BX248287 mRNA. Translation: CAD62615.1. Different initiation.
AL137226 Genomic DNA. No translation available.
BC005197 mRNA. Translation: AAH05197.1.
BC016821 mRNA. Translation: AAH16821.1.
RefSeqNP_001138363.1. NM_001144891.1.
NP_057670.2. NM_016586.2.
XP_005267812.1. XM_005267755.2.
UniGeneHs.368647.

3D structure databases

ProteinModelPortalQ9NS73.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119612. 37 interactions.
IntActQ9NS73. 24 interactions.
MINTMINT-1443700.
STRING9606.ENSP00000324444.

PTM databases

PhosphoSiteQ9NS73.

Polymorphism databases

DMDM160112798.

Proteomic databases

PaxDbQ9NS73.
PRIDEQ9NS73.

Protocols and materials databases

DNASU51562.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000318473; ENSP00000324444; ENSG00000151332. [Q9NS73-5]
ENST00000359527; ENSP00000352517; ENSG00000151332. [Q9NS73-3]
ENST00000416007; ENSP00000399718; ENSG00000151332. [Q9NS73-1]
GeneID51562.
KEGGhsa:51562.
UCSCuc001wtm.2. human. [Q9NS73-1]
uc001wtn.2. human. [Q9NS73-3]
uc001wto.2. human. [Q9NS73-5]

Organism-specific databases

CTD51562.
GeneCardsGC14M036767.
H-InvDBHIX0011602.
HGNCHGNC:20427. MBIP.
HPAHPA003388.
MIM609431. gene.
neXtProtNX_Q9NS73.
PharmGKBPA134929415.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG39394.
HOGENOMHOG000113491.
HOVERGENHBG052420.
InParanoidQ9NS73.
OMAVKITIDW.
OrthoDBEOG77M8P4.
PhylomeDBQ9NS73.
TreeFamTF331763.

Enzyme and pathway databases

ReactomeREACT_172623. Chromatin organization.
SignaLinkQ9NS73.

Gene expression databases

ArrayExpressQ9NS73.
BgeeQ9NS73.
CleanExHS_MBIP.
GenevestigatorQ9NS73.

Family and domain databases

InterProIPR026062. MBIP.
[Graphical view]
PANTHERPTHR23404:SF3. PTHR23404:SF3. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi51562.
NextBio55366.
PROQ9NS73.
SOURCESearch...

Entry information

Entry nameMBIP1_HUMAN
AccessionPrimary (citable) accession number: Q9NS73
Secondary accession number(s): Q86TZ2 expand/collapse secondary AC list , Q96AS5, Q9BS93, Q9NZE1
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: November 13, 2007
Last modified: April 16, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM