Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NS73

- MBIP1_HUMAN

UniProt

Q9NS73 - MBIP1_HUMAN

Protein

MAP3K12-binding inhibitory protein 1

Gene

MBIP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.1 Publication

    GO - Molecular functioni

    1. identical protein binding Source: IntAct
    2. protein binding Source: IntAct
    3. protein kinase inhibitor activity Source: ProtInc

    GO - Biological processi

    1. chromatin organization Source: Reactome
    2. histone H3 acetylation Source: BHF-UCL
    3. inactivation of MAPK activity involved in osmosensory signaling pathway Source: ProtInc

    Enzyme and pathway databases

    ReactomeiREACT_172610. HATs acetylate histones.
    SignaLinkiQ9NS73.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MAP3K12-binding inhibitory protein 1
    Alternative name(s):
    MAPK upstream kinase-binding inhibitory protein
    Short name:
    MUK-binding inhibitory protein
    Gene namesi
    Name:MBIP
    ORF Names:BM-015
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:20427. MBIP.

    Subcellular locationi

    Nucleus. Cytoplasm
    Note: Shows a cytoplasmic localization when coexpressed with MAP3K12.

    GO - Cellular componenti

    1. Ada2/Gcn5/Ada3 transcription activator complex Source: BHF-UCL
    2. cytoplasm Source: HPA
    3. nucleolus Source: HPA
    4. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134929415.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 344344MAP3K12-binding inhibitory protein 1PRO_0000096269Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei91 – 911Phosphoserine3 Publications
    Modified residuei301 – 3011N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9NS73.
    PaxDbiQ9NS73.
    PRIDEiQ9NS73.

    PTM databases

    PhosphoSiteiQ9NS73.

    Expressioni

    Tissue specificityi

    Ubiquitous. High expression seen in the heart and lung.

    Gene expression databases

    ArrayExpressiQ9NS73.
    BgeeiQ9NS73.
    CleanExiHS_MBIP.
    GenevestigatoriQ9NS73.

    Organism-specific databases

    HPAiHPA003388.

    Interactioni

    Subunit structurei

    Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. In the complex, it probably interacts directly with KAT2A, CSRP2BP and WDR5.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself3EBI-741953,EBI-741953
    CSRP2BPQ9H8E83EBI-741953,EBI-750907
    EPB41L3Q96HL73EBI-741953,EBI-749393
    FXR2P511163EBI-741953,EBI-740459
    PLEKHF2Q9H8W43EBI-741953,EBI-742388
    PPFIA1Q131363EBI-741953,EBI-745426

    Protein-protein interaction databases

    BioGridi119612. 37 interactions.
    IntActiQ9NS73. 24 interactions.
    MINTiMINT-1443700.
    STRINGi9606.ENSP00000324444.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NS73.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni172 – 344173Interaction with MAP3K12Add
    BLAST
    Regioni271 – 28515Leucine-zipper 1Sequence AnalysisAdd
    BLAST
    Regioni314 – 32916Leucine-zipper 2Sequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG39394.
    HOGENOMiHOG000113491.
    HOVERGENiHBG052420.
    InParanoidiQ9NS73.
    OMAiVKITIDW.
    OrthoDBiEOG77M8P4.
    PhylomeDBiQ9NS73.
    TreeFamiTF331763.

    Family and domain databases

    InterProiIPR026062. MBIP.
    [Graphical view]
    PANTHERiPTHR23404:SF3. PTHR23404:SF3. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NS73-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAATELNRP SSGDRNLERR CRPNLSREVL YEIFRSLHTL VGQLDLRDDV    50
    VKITIDWNKL QSLSAFQPAL LFSALEQHIL YLQPFLAKLQ SPIKEENTTA 100
    VEEIGRTEMG NKNEVNDKFS IGDLQEEEKH KESDLRDVKK TQIHFDPEVV 150
    QIKAGKAEID RRISAFIERK QAEINENNVR EFCNVIDCNQ ENSCARTDAI 200
    FTPYPGFKSH VKVSRVVNTY GPQTRPEGIP GSGHKPNSML RDCGNQAVEE 250
    RLQNIEAHLR LQTGGPVPRD IYQRIKKLED KILELEGISP EYFQSVSFSG 300
    KRRKVQPPQQ NYSLAELDEK ISALKQALLR KSREAESMAT HHLP 344
    Length:344
    Mass (Da):39,281
    Last modified:November 13, 2007 - v2
    Checksum:i9DABB35CA8695C02
    GO
    Isoform 2 (identifier: Q9NS73-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         298-344: FSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP → L

    Note: No experimental confirmation available.

    Show »
    Length:298
    Mass (Da):34,023
    Checksum:i00856BC8902FA9B3
    GO
    Isoform 3 (identifier: Q9NS73-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         264-344: GGPVPRDIYQ...AESMATHHLP → ELFWKKKKSSTTSTELFTG

    Show »
    Length:282
    Mass (Da):32,223
    Checksum:i4BD1C926F718E3B7
    GO
    Isoform 4 (identifier: Q9NS73-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         309-309: Missing.

    Show »
    Length:343
    Mass (Da):39,153
    Checksum:i97D44D5E8AB7DE60
    GO

    Sequence cautioni

    The sequence CAD62615.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti218 – 2181N → Y in AAH05197. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti7 – 71L → H.3 Publications
    Corresponds to variant rs2899849 [ dbSNP | Ensembl ].
    VAR_018449
    Natural varianti22 – 221R → S.3 Publications
    Corresponds to variant rs3168891 [ dbSNP | Ensembl ].
    VAR_034093

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei264 – 34481GGPVP…THHLP → ELFWKKKKSSTTSTELFTG in isoform 3. 1 PublicationVSP_010265Add
    BLAST
    Alternative sequencei298 – 34447FSGKR…THHLP → L in isoform 2. 1 PublicationVSP_010266Add
    BLAST
    Alternative sequencei309 – 3091Missing in isoform 4. 1 PublicationVSP_040134

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB038523 mRNA. Translation: BAA94083.1.
    AF208857 mRNA. Translation: AAF64271.1.
    BX248287 mRNA. Translation: CAD62615.1. Different initiation.
    AL137226 Genomic DNA. No translation available.
    BC005197 mRNA. Translation: AAH05197.1.
    BC016821 mRNA. Translation: AAH16821.1.
    CCDSiCCDS45096.1. [Q9NS73-5]
    CCDS9658.1. [Q9NS73-1]
    RefSeqiNP_001138363.1. NM_001144891.1. [Q9NS73-5]
    NP_057670.2. NM_016586.2. [Q9NS73-1]
    XP_005267812.1. XM_005267755.2. [Q9NS73-3]
    UniGeneiHs.368647.

    Genome annotation databases

    EnsembliENST00000318473; ENSP00000324444; ENSG00000151332. [Q9NS73-5]
    ENST00000359527; ENSP00000352517; ENSG00000151332. [Q9NS73-3]
    ENST00000416007; ENSP00000399718; ENSG00000151332. [Q9NS73-1]
    GeneIDi51562.
    KEGGihsa:51562.
    UCSCiuc001wtm.2. human. [Q9NS73-1]
    uc001wtn.2. human. [Q9NS73-3]
    uc001wto.2. human. [Q9NS73-5]

    Polymorphism databases

    DMDMi160112798.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB038523 mRNA. Translation: BAA94083.1 .
    AF208857 mRNA. Translation: AAF64271.1 .
    BX248287 mRNA. Translation: CAD62615.1 . Different initiation.
    AL137226 Genomic DNA. No translation available.
    BC005197 mRNA. Translation: AAH05197.1 .
    BC016821 mRNA. Translation: AAH16821.1 .
    CCDSi CCDS45096.1. [Q9NS73-5 ]
    CCDS9658.1. [Q9NS73-1 ]
    RefSeqi NP_001138363.1. NM_001144891.1. [Q9NS73-5 ]
    NP_057670.2. NM_016586.2. [Q9NS73-1 ]
    XP_005267812.1. XM_005267755.2. [Q9NS73-3 ]
    UniGenei Hs.368647.

    3D structure databases

    ProteinModelPortali Q9NS73.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119612. 37 interactions.
    IntActi Q9NS73. 24 interactions.
    MINTi MINT-1443700.
    STRINGi 9606.ENSP00000324444.

    PTM databases

    PhosphoSitei Q9NS73.

    Polymorphism databases

    DMDMi 160112798.

    Proteomic databases

    MaxQBi Q9NS73.
    PaxDbi Q9NS73.
    PRIDEi Q9NS73.

    Protocols and materials databases

    DNASUi 51562.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318473 ; ENSP00000324444 ; ENSG00000151332 . [Q9NS73-5 ]
    ENST00000359527 ; ENSP00000352517 ; ENSG00000151332 . [Q9NS73-3 ]
    ENST00000416007 ; ENSP00000399718 ; ENSG00000151332 . [Q9NS73-1 ]
    GeneIDi 51562.
    KEGGi hsa:51562.
    UCSCi uc001wtm.2. human. [Q9NS73-1 ]
    uc001wtn.2. human. [Q9NS73-3 ]
    uc001wto.2. human. [Q9NS73-5 ]

    Organism-specific databases

    CTDi 51562.
    GeneCardsi GC14M036767.
    H-InvDB HIX0011602.
    HGNCi HGNC:20427. MBIP.
    HPAi HPA003388.
    MIMi 609431. gene.
    neXtProti NX_Q9NS73.
    PharmGKBi PA134929415.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG39394.
    HOGENOMi HOG000113491.
    HOVERGENi HBG052420.
    InParanoidi Q9NS73.
    OMAi VKITIDW.
    OrthoDBi EOG77M8P4.
    PhylomeDBi Q9NS73.
    TreeFami TF331763.

    Enzyme and pathway databases

    Reactomei REACT_172610. HATs acetylate histones.
    SignaLinki Q9NS73.

    Miscellaneous databases

    GenomeRNAii 51562.
    NextBioi 55366.
    PROi Q9NS73.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NS73.
    Bgeei Q9NS73.
    CleanExi HS_MBIP.
    Genevestigatori Q9NS73.

    Family and domain databases

    InterProi IPR026062. MBIP.
    [Graphical view ]
    PANTHERi PTHR23404:SF3. PTHR23404:SF3. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "MAPK upstream kinase (MUK)-binding inhibitory protein, a negative regulator of MUK/Dual leucine zipper-bearing kinase/leucine zipper protein kinase."
      Fukuyama K., Yoshida M., Yamashita A., Deyama T., Baba M., Suzuki A., Mohri H., Ikezawa Z., Nakajima H., Hirai S., Ohno S.
      J. Biol. Chem. 275:21247-21254(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-7 AND SER-22.
      Tissue: Kidney.
    2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-7 AND SER-22.
      Tissue: Bone marrow.
    3. "Full-length cDNA libraries and normalization."
      Li W.B., Gruber C., Jessee J., Polayes D.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Placenta.
    4. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS HIS-7 AND SER-22.
      Tissue: Bone marrow and Urinary bladder.
    6. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
      Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
      Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiMBIP1_HUMAN
    AccessioniPrimary (citable) accession number: Q9NS73
    Secondary accession number(s): Q86TZ2
    , Q96AS5, Q9BS93, Q9NZE1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2004
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 106 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3