SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NS73

- MBIP1_HUMAN

UniProt

Q9NS73 - MBIP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
MAP3K12-binding inhibitory protein 1
Gene
MBIP, BM-015
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.1 Publication

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. protein binding Source: IntAct
  3. protein kinase inhibitor activity Source: ProtInc

GO - Biological processi

  1. chromatin organization Source: Reactome
  2. histone H3 acetylation Source: BHF-UCL
  3. inactivation of MAPK activity involved in osmosensory signaling pathway Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_172610. HATs acetylate histones.
SignaLinkiQ9NS73.

Names & Taxonomyi

Protein namesi
Recommended name:
MAP3K12-binding inhibitory protein 1
Alternative name(s):
MAPK upstream kinase-binding inhibitory protein
Short name:
MUK-binding inhibitory protein
Gene namesi
Name:MBIP
ORF Names:BM-015
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:20427. MBIP.

Subcellular locationi

Nucleus. Cytoplasm
Note: Shows a cytoplasmic localization when coexpressed with MAP3K12.

GO - Cellular componenti

  1. Ada2/Gcn5/Ada3 transcription activator complex Source: BHF-UCL
  2. cytoplasm Source: HPA
  3. nucleolus Source: HPA
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134929415.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344MAP3K12-binding inhibitory protein 1
PRO_0000096269Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei91 – 911Phosphoserine3 Publications
Modified residuei301 – 3011N6-acetyllysine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9NS73.
PaxDbiQ9NS73.
PRIDEiQ9NS73.

PTM databases

PhosphoSiteiQ9NS73.

Expressioni

Tissue specificityi

Ubiquitous. High expression seen in the heart and lung.

Gene expression databases

ArrayExpressiQ9NS73.
BgeeiQ9NS73.
CleanExiHS_MBIP.
GenevestigatoriQ9NS73.

Organism-specific databases

HPAiHPA003388.

Interactioni

Subunit structurei

Component of the ADA2A-containing complex (ATAC), composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. In the complex, it probably interacts directly with KAT2A, CSRP2BP and WDR5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-741953,EBI-741953
CSRP2BPQ9H8E83EBI-741953,EBI-750907
EPB41L3Q96HL73EBI-741953,EBI-749393
FXR2P511163EBI-741953,EBI-740459
PLEKHF2Q9H8W43EBI-741953,EBI-742388
PPFIA1Q131363EBI-741953,EBI-745426

Protein-protein interaction databases

BioGridi119612. 37 interactions.
IntActiQ9NS73. 24 interactions.
MINTiMINT-1443700.
STRINGi9606.ENSP00000324444.

Structurei

3D structure databases

ProteinModelPortaliQ9NS73.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni172 – 344173Interaction with MAP3K12
Add
BLAST
Regioni271 – 28515Leucine-zipper 1 Reviewed prediction
Add
BLAST
Regioni314 – 32916Leucine-zipper 2 Reviewed prediction
Add
BLAST

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG39394.
HOGENOMiHOG000113491.
HOVERGENiHBG052420.
InParanoidiQ9NS73.
OMAiVKITIDW.
OrthoDBiEOG77M8P4.
PhylomeDBiQ9NS73.
TreeFamiTF331763.

Family and domain databases

InterProiIPR026062. MBIP.
[Graphical view]
PANTHERiPTHR23404:SF3. PTHR23404:SF3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NS73-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAATELNRP SSGDRNLERR CRPNLSREVL YEIFRSLHTL VGQLDLRDDV    50
VKITIDWNKL QSLSAFQPAL LFSALEQHIL YLQPFLAKLQ SPIKEENTTA 100
VEEIGRTEMG NKNEVNDKFS IGDLQEEEKH KESDLRDVKK TQIHFDPEVV 150
QIKAGKAEID RRISAFIERK QAEINENNVR EFCNVIDCNQ ENSCARTDAI 200
FTPYPGFKSH VKVSRVVNTY GPQTRPEGIP GSGHKPNSML RDCGNQAVEE 250
RLQNIEAHLR LQTGGPVPRD IYQRIKKLED KILELEGISP EYFQSVSFSG 300
KRRKVQPPQQ NYSLAELDEK ISALKQALLR KSREAESMAT HHLP 344
Length:344
Mass (Da):39,281
Last modified:November 13, 2007 - v2
Checksum:i9DABB35CA8695C02
GO
Isoform 2 (identifier: Q9NS73-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-344: FSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP → L

Note: No experimental confirmation available.

Show »
Length:298
Mass (Da):34,023
Checksum:i00856BC8902FA9B3
GO
Isoform 3 (identifier: Q9NS73-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-344: GGPVPRDIYQ...AESMATHHLP → ELFWKKKKSSTTSTELFTG

Show »
Length:282
Mass (Da):32,223
Checksum:i4BD1C926F718E3B7
GO
Isoform 4 (identifier: Q9NS73-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: Missing.

Show »
Length:343
Mass (Da):39,153
Checksum:i97D44D5E8AB7DE60
GO

Sequence cautioni

The sequence CAD62615.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71L → H.3 Publications
Corresponds to variant rs2899849 [ dbSNP | Ensembl ].
VAR_018449
Natural varianti22 – 221R → S.3 Publications
Corresponds to variant rs3168891 [ dbSNP | Ensembl ].
VAR_034093

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei264 – 34481GGPVP…THHLP → ELFWKKKKSSTTSTELFTG in isoform 3.
VSP_010265Add
BLAST
Alternative sequencei298 – 34447FSGKR…THHLP → L in isoform 2.
VSP_010266Add
BLAST
Alternative sequencei309 – 3091Missing in isoform 4.
VSP_040134

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti218 – 2181N → Y in AAH05197. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB038523 mRNA. Translation: BAA94083.1.
AF208857 mRNA. Translation: AAF64271.1.
BX248287 mRNA. Translation: CAD62615.1. Different initiation.
AL137226 Genomic DNA. No translation available.
BC005197 mRNA. Translation: AAH05197.1.
BC016821 mRNA. Translation: AAH16821.1.
CCDSiCCDS45096.1. [Q9NS73-5]
CCDS9658.1. [Q9NS73-1]
RefSeqiNP_001138363.1. NM_001144891.1. [Q9NS73-5]
NP_057670.2. NM_016586.2. [Q9NS73-1]
XP_005267812.1. XM_005267755.2. [Q9NS73-3]
UniGeneiHs.368647.

Genome annotation databases

EnsembliENST00000318473; ENSP00000324444; ENSG00000151332. [Q9NS73-5]
ENST00000359527; ENSP00000352517; ENSG00000151332. [Q9NS73-3]
ENST00000416007; ENSP00000399718; ENSG00000151332. [Q9NS73-1]
GeneIDi51562.
KEGGihsa:51562.
UCSCiuc001wtm.2. human. [Q9NS73-1]
uc001wtn.2. human. [Q9NS73-3]
uc001wto.2. human. [Q9NS73-5]

Polymorphism databases

DMDMi160112798.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB038523 mRNA. Translation: BAA94083.1 .
AF208857 mRNA. Translation: AAF64271.1 .
BX248287 mRNA. Translation: CAD62615.1 . Different initiation.
AL137226 Genomic DNA. No translation available.
BC005197 mRNA. Translation: AAH05197.1 .
BC016821 mRNA. Translation: AAH16821.1 .
CCDSi CCDS45096.1. [Q9NS73-5 ]
CCDS9658.1. [Q9NS73-1 ]
RefSeqi NP_001138363.1. NM_001144891.1. [Q9NS73-5 ]
NP_057670.2. NM_016586.2. [Q9NS73-1 ]
XP_005267812.1. XM_005267755.2. [Q9NS73-3 ]
UniGenei Hs.368647.

3D structure databases

ProteinModelPortali Q9NS73.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119612. 37 interactions.
IntActi Q9NS73. 24 interactions.
MINTi MINT-1443700.
STRINGi 9606.ENSP00000324444.

PTM databases

PhosphoSitei Q9NS73.

Polymorphism databases

DMDMi 160112798.

Proteomic databases

MaxQBi Q9NS73.
PaxDbi Q9NS73.
PRIDEi Q9NS73.

Protocols and materials databases

DNASUi 51562.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000318473 ; ENSP00000324444 ; ENSG00000151332 . [Q9NS73-5 ]
ENST00000359527 ; ENSP00000352517 ; ENSG00000151332 . [Q9NS73-3 ]
ENST00000416007 ; ENSP00000399718 ; ENSG00000151332 . [Q9NS73-1 ]
GeneIDi 51562.
KEGGi hsa:51562.
UCSCi uc001wtm.2. human. [Q9NS73-1 ]
uc001wtn.2. human. [Q9NS73-3 ]
uc001wto.2. human. [Q9NS73-5 ]

Organism-specific databases

CTDi 51562.
GeneCardsi GC14M036767.
H-InvDB HIX0011602.
HGNCi HGNC:20427. MBIP.
HPAi HPA003388.
MIMi 609431. gene.
neXtProti NX_Q9NS73.
PharmGKBi PA134929415.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG39394.
HOGENOMi HOG000113491.
HOVERGENi HBG052420.
InParanoidi Q9NS73.
OMAi VKITIDW.
OrthoDBi EOG77M8P4.
PhylomeDBi Q9NS73.
TreeFami TF331763.

Enzyme and pathway databases

Reactomei REACT_172610. HATs acetylate histones.
SignaLinki Q9NS73.

Miscellaneous databases

GenomeRNAii 51562.
NextBioi 55366.
PROi Q9NS73.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NS73.
Bgeei Q9NS73.
CleanExi HS_MBIP.
Genevestigatori Q9NS73.

Family and domain databases

InterProi IPR026062. MBIP.
[Graphical view ]
PANTHERi PTHR23404:SF3. PTHR23404:SF3. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "MAPK upstream kinase (MUK)-binding inhibitory protein, a negative regulator of MUK/Dual leucine zipper-bearing kinase/leucine zipper protein kinase."
    Fukuyama K., Yoshida M., Yamashita A., Deyama T., Baba M., Suzuki A., Mohri H., Ikezawa Z., Nakajima H., Hirai S., Ohno S.
    J. Biol. Chem. 275:21247-21254(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-7 AND SER-22.
    Tissue: Kidney.
  2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-7 AND SER-22.
    Tissue: Bone marrow.
  3. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Placenta.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS HIS-7 AND SER-22.
    Tissue: Bone marrow and Urinary bladder.
  6. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "The double-histone-acetyltransferase complex ATAC is essential for mammalian development."
    Guelman S., Kozuka K., Mao Y., Pham V., Solloway M.J., Wang J., Wu J., Lill J.R., Zha J.
    Mol. Cell. Biol. 29:1176-1188(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN ATAC COMPLEX.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-91, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiMBIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NS73
Secondary accession number(s): Q86TZ2
, Q96AS5, Q9BS93, Q9NZE1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: November 13, 2007
Last modified: September 3, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi