Q9NRY7 (PLS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phospholipid scramblase 2 Short name=PL scramblase 2 Alternative name(s): Ca(2+)-dependent phospholipid scramblase 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 224 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. |
| Cofactor | Calcium By similarity. |
| Subcellular location | Membrane; Single-pass type II membrane protein By similarity. |
| Tissue specificity | Exclusively expressed in testis. |
| Sequence similarities | Belongs to the phospholipid scramblase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Calcium Metal-binding |
| PTM | Lipoprotein Palmitate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phospholipid scrambling Non-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneNon-traceable author statement Ref.1. Source: UniProtKB |
| Molecular_function | calcium ion binding Non-traceable author statement Ref.1. Source: UniProtKB phospholipid scramblase activityNon-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRY7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRY7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEGVPWM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 224 | 224 | Phospholipid scramblase 2 | PRO_0000100787 | |||||
Regions | |||||||||
| Topological domain | 1 – 203 | 203 | Cytoplasmic By similarity | ||||||
| Transmembrane | 204 – 220 | 17 | Helical; Potential | ||||||
| Topological domain | 221 – 224 | 4 | Extracellular By similarity | ||||||
| Compositional bias | 2 – 7 | 6 | Poly-Pro | ||||||
| Compositional bias | 96 – 104 | 9 | Cys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 76 | 1 | Phosphothreonine; by PKC By similarity | ||||||
| Lipidation | 149 | 1 | S-palmitoyl cysteine Probable | ||||||
| Lipidation | 152 | 1 | S-palmitoyl cysteine Probable | ||||||
| Lipidation | 154 | 1 | S-palmitoyl cysteine Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRSWNSLFCLNSSRPPGHIV YPKHQAGHTGKQADHLGSQA FYPGRQHDYLVPPAGTAGIP VQNQPGRPEGVPWM in isoform 2. | VSP_045894 | |||||
Experimental info | |||||||||
| Sequence conflict | 199 – 201 | 3 | DLD → NLN in BAG63335. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of three new members of the phospholipid scramblase gene family." Wiedmer T., Zhou Q., Kwoh D.Y., Sims P.J. Biochim. Biophys. Acta 1467:244-253(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CALCIUM-BINDING. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [3] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
Web resources
| Wikipedia Scramblase entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF159441 mRNA. Translation: AAF91082.1. AK301909 mRNA. Translation: BAG63335.1. AC069528 Genomic DNA. No translation available. BC069785 mRNA. Translation: AAH69785.2. BC120969 mRNA. Translation: AAI20970.1. BC141969 mRNA. Translation: AAI41970.1. |
| IPI | IPI00016940. IPI00946560. |
| RefSeq | NP_001186907.1. NM_001199978.1. |
| UniGene | Hs.177968. |
3D structure databases | |
| ProteinModelPortal | Q9NRY7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NRY7. 1 interaction. |
Polymorphism databases | |
| DMDM | 14548198. |
Proteomic databases | |
| PaxDb | Q9NRY7. |
| PRIDE | Q9NRY7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000336685; ENSP00000338707; ENSG00000163746. ENST00000497985; ENSP00000420132; ENSG00000163746. |
| GeneID | 57047. |
| KEGG | hsa:57047. |
| UCSC | uc003evv.2. human. |
Organism-specific databases | |
| CTD | 57047. |
| GeneCards | GC03M146110. |
| H-InvDB | HIX0200552. |
| HGNC | HGNC:16494. PLSCR2. |
| HPA | HPA051352. |
| MIM | 607610. gene. |
| neXtProt | NX_Q9NRY7. |
| PharmGKB | PA33420. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG119855. |
| HOGENOM | HOG000237356. |
| HOVERGEN | HBG019157. |
| InParanoid | Q9NRY7. |
| PhylomeDB | Q9NRY7. |
Gene expression databases | |
| ArrayExpress | Q9NRY7. |
| Bgee | Q9NRY7. |
| CleanEx | HS_PLSCR2. |
| Genevestigator | Q9NRY7. |
| GermOnline | ENSG00000163746. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005552. Scramblase. [Graphical view] |
| PANTHER | PTHR23248. PTHR23248. 1 hit. |
| Pfam | PF03803. Scramblase. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 57047. |
| NextBio | 35535500. |
| SOURCE | Search... |
Entry information
| Entry name | PLS2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRY7 Secondary accession number(s): B4DXC3 Q6NSW9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
