Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NRY7 (PLS2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phospholipid scramblase 2

Short name=PL scramblase 2
Alternative name(s):
Ca(2+)-dependent phospholipid scramblase 2
Gene names
Name:PLSCR2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length224 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Cofactor

Calcium By similarity.

Subcellular location

Membrane; Single-pass type II membrane protein By similarity.

Tissue specificity

Exclusively expressed in testis.

Sequence similarities

Belongs to the phospholipid scramblase family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NRY7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NRY7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEGVPWM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 224224Phospholipid scramblase 2
PRO_0000100787

Regions

Topological domain1 – 203203Cytoplasmic By similarity
Transmembrane204 – 22017Helical; Potential
Topological domain221 – 2244Extracellular By similarity
Compositional bias2 – 76Poly-Pro
Compositional bias96 – 1049Cys-rich

Amino acid modifications

Modified residue761Phosphothreonine; by PKC By similarity
Lipidation1491S-palmitoyl cysteine Probable
Lipidation1521S-palmitoyl cysteine Probable
Lipidation1541S-palmitoyl cysteine Probable

Natural variations

Alternative sequence11M → MRSWNSLFCLNSSRPPGHIV YPKHQAGHTGKQADHLGSQA FYPGRQHDYLVPPAGTAGIP VQNQPGRPEGVPWM in isoform 2.
VSP_045894

Experimental info

Sequence conflict199 – 2013DLD → NLN in BAG63335. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: FD218C63C59D239A

FASTA22425,523
        10         20         30         40         50         60 
MPAPPPPLNC PPGLEYLSQI DMILIHQQIE LLEVLFSFES SNMYEIKNSF GQRIYFAAED 

        70         80         90        100        110        120 
TNFCIRNCCG RSRPFTLRIT DNVGREVITL ERPLRCNCCC CPCCLQEIEI QAPPGVPVGY 

       130        140        150        160        170        180 
VTQTWHPCLT KFTIKNQKRE DVLKISGPCI VCSCIAGVDF EITSLDEQIV VGRISKHWSG 

       190        200        210        220 
FLREAFTDAD NFGIQFPRDL DVKMKAVMIG ACFLIDYMFF ERTR 

« Hide

Isoform 2 [UniParc].

Checksum: 58F50C24AB438729
Show »

FASTA29733,504

References

« Hide 'large scale' references
[1]"Identification of three new members of the phospholipid scramblase gene family."
Wiedmer T., Zhou Q., Kwoh D.Y., Sims P.J.
Biochim. Biophys. Acta 1467:244-253(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CALCIUM-BINDING.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[3]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Web resources

Wikipedia

Scramblase entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF159441 mRNA. Translation: AAF91082.1.
AK301909 mRNA. Translation: BAG63335.1.
AC069528 Genomic DNA. No translation available.
BC069785 mRNA. Translation: AAH69785.2.
BC120969 mRNA. Translation: AAI20970.1.
BC141969 mRNA. Translation: AAI41970.1.
RefSeqNP_001186907.1. NM_001199978.1.
UniGeneHs.744414.

3D structure databases

ProteinModelPortalQ9NRY7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121340. 1 interaction.
IntActQ9NRY7. 1 interaction.

Proteomic databases

PaxDbQ9NRY7.
PRIDEQ9NRY7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000336685; ENSP00000338707; ENSG00000163746. [Q9NRY7-1]
ENST00000497985; ENSP00000420132; ENSG00000163746. [Q9NRY7-2]
GeneID57047.
KEGGhsa:57047.
UCSCuc003evv.2. human. [Q9NRY7-1]

Organism-specific databases

CTD57047.
GeneCardsGC03M146110.
H-InvDBHIX0200552.
HGNCHGNC:16494. PLSCR2.
HPAHPA051352.
MIM607610. gene.
neXtProtNX_Q9NRY7.
PharmGKBPA33420.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG119855.
HOGENOMHOG000237356.
HOVERGENHBG019157.
InParanoidQ9NRY7.
OMAPLRCNCC.
PhylomeDBQ9NRY7.
TreeFamTF314939.

Gene expression databases

ArrayExpressQ9NRY7.
BgeeQ9NRY7.
CleanExHS_PLSCR2.
GenevestigatorQ9NRY7.

Family and domain databases

InterProIPR005552. Scramblase.
[Graphical view]
PANTHERPTHR23248. PTHR23248. 1 hit.
PfamPF03803. Scramblase. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiPLSCR2.
GenomeRNAi57047.
NextBio35535500.
PROQ9NRY7.
SOURCESearch...

Entry information

Entry namePLS2_HUMAN
AccessionPrimary (citable) accession number: Q9NRY7
Secondary accession number(s): B4DXC3 expand/collapse secondary AC list , J3KR76, Q0VAQ1, Q6NSW9
Entry history
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: April 16, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM