Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

14 kDa phosphohistidine phosphatase

Gene

PHPT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Exhibits phosphohistidine phosphatase activity.2 Publications

Catalytic activityi

A [protein]-N-phospho-L-histidine + H2O = a [protein]-L-histidine + phosphate.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei21Substrate1 Publication1
Active sitei53Proton acceptor1 Publication1

GO - Molecular functioni

  • calcium channel inhibitor activity Source: BHF-UCL
  • ion channel binding Source: BHF-UCL
  • phosphohistidine phosphatase activity Source: BHF-UCL
  • phosphoprotein phosphatase activity Source: UniProtKB-KW

GO - Biological processi

  • negative regulation of ATP citrate synthase activity Source: BHF-UCL
  • negative regulation of lyase activity Source: BHF-UCL
  • negative regulation of T cell receptor signaling pathway Source: BHF-UCL
  • peptidyl-histidine dephosphorylation Source: BHF-UCL
  • positive regulation of cell motility Source: BHF-UCL
  • positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
  • protein dephosphorylation Source: BHF-UCL
  • regulation of actin cytoskeleton reorganization Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000054148-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
14 kDa phosphohistidine phosphatase1 Publication (EC:3.9.1.32 Publications)
Alternative name(s):
Phosphohistidine phosphatase 11 Publication
Short name:
PHPT11 Publication
Protein histidine phosphatase1 Publication
Short name:
PHP1 Publication
Protein janus-A homolog
Gene namesi
Name:PHPT1
Synonyms:PHP14
ORF Names:CGI-202, HSPC141
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:30033. PHPT1.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: BHF-UCL
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi21K → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1 Publication1
Mutagenesisi45R → A: Slightly decreased affinity for substrate, but no effect on catalytic activity. 2 Publications1
Mutagenesisi53H → A: Loss of activity. 2 Publications1
Mutagenesisi78R → A: Decreased affinity for substrate and reduced catalytic activity. 2 Publications1
Mutagenesisi94S → A: Decreased affinity for substrate and strongly reduced catalytic activity. 1
Mutagenesisi102H → A: Decreased affinity for substrate and slightly reduced catalytic activity. 2 Publications1

Organism-specific databases

DisGeNETi29085.
OpenTargetsiENSG00000054148.
PharmGKBiPA134948141.

Polymorphism and mutation databases

DMDMi25008934.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002061522 – 12514 kDa phosphohistidine phosphataseAdd BLAST124

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9NRX4.
PaxDbiQ9NRX4.
PeptideAtlasiQ9NRX4.
PRIDEiQ9NRX4.
TopDownProteomicsiQ9NRX4-1. [Q9NRX4-1]

PTM databases

DEPODiQ9NRX4.
iPTMnetiQ9NRX4.
PhosphoSitePlusiQ9NRX4.

Expressioni

Tissue specificityi

Expressed abundantly in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000054148.
CleanExiHS_PHPT1.
ExpressionAtlasiQ9NRX4. baseline and differential.
GenevisibleiQ9NRX4. HS.

Organism-specific databases

HPAiCAB013584.
HPA020952.

Interactioni

Subunit structurei

Monomer.1 Publication

GO - Molecular functioni

  • ion channel binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi118854. 19 interactors.
DIPiDIP-48597N.
IntActiQ9NRX4. 3 interactors.
MINTiMINT-1394164.
STRINGi9606.ENSP00000247665.

Structurei

Secondary structure

1125
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi6 – 8Combined sources3
Beta strandi11 – 14Combined sources4
Beta strandi17 – 28Combined sources12
Helixi31 – 33Combined sources3
Beta strandi40 – 46Combined sources7
Helixi53 – 66Combined sources14
Beta strandi70 – 82Combined sources13
Turni83 – 86Combined sources4
Beta strandi87 – 91Combined sources5
Turni95 – 97Combined sources3
Helixi102 – 112Combined sources11
Beta strandi116 – 120Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AI6NMR-A1-125[»]
2HW4X-ray1.90A5-125[»]
2NMMX-ray2.70A/B/C1-125[»]
2OZWNMR-A1-125[»]
2OZXNMR-A1-125[»]
ProteinModelPortaliQ9NRX4.
SMRiQ9NRX4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NRX4.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni94 – 96Substrate binding1 Publication3

Sequence similaritiesi

Belongs to the janus family.Curated

Phylogenomic databases

eggNOGiENOG410IZ5G. Eukaryota.
ENOG4111SA6. LUCA.
GeneTreeiENSGT00390000002738.
HOGENOMiHOG000231559.
HOVERGENiHBG053589.
InParanoidiQ9NRX4.
KOiK01112.
OMAiGWAEYHA.
OrthoDBiEOG091G10Y7.
PhylomeDBiQ9NRX4.
TreeFamiTF315158.

Family and domain databases

InterProiIPR007702. Janus.
IPR028441. PHPT1.
[Graphical view]
PANTHERiPTHR12258:SF10. PTHR12258:SF10. 1 hit.
PfamiPF05005. Ocnus. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NRX4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVADLALIP DVDIDSDGVF KYVLIRVHSA PRSGAPAAES KEIVRGYKWA
60 70 80 90 100
EYHADIYDKV SGDMQKQGCD CECLGGGRIS HQSQDKKIHV YGYSMAYGPA
110 120
QHAISTEKIK AKYPDYEVTW ANDGY
Length:125
Mass (Da):13,833
Last modified:October 1, 2000 - v1
Checksum:i24F0CA2BADB78478
GO
Isoform 2 (identifier: Q9NRX4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-125: AYGPAQHAISTEKIKAKYPDYEVTWANDGY → MRPTCVPLGASGPRIHHQGLWSCPARHFN

Show »
Length:124
Mass (Da):13,672
Checksum:iB504A355D275D9C6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14I → T in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti27V → I in CAB66579 (PubMed:11230166).Curated1
Sequence conflicti79I → T in CAB66579 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04115996 – 125AYGPA…ANDGY → MRPTCVPLGASGPRIHHQGL WSCPARHFN in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF393504 mRNA. Translation: AAN52504.1.
AF164795 mRNA. Translation: AAF80759.1.
AF285119 mRNA. Translation: AAG01156.1.
AL136644 mRNA. Translation: CAB66579.1.
AL355987 Genomic DNA. Translation: CAI12692.1.
AL355987 Genomic DNA. Translation: CAI12693.1.
CH471090 Genomic DNA. Translation: EAW88289.1.
BC024648 mRNA. Translation: AAH24648.1.
BQ922335 mRNA. No translation available.
CCDSiCCDS48060.1. [Q9NRX4-2]
CCDS7009.1. [Q9NRX4-1]
RefSeqiNP_001129333.1. NM_001135861.2. [Q9NRX4-2]
NP_054891.2. NM_014172.5. [Q9NRX4-1]
UniGeneiHs.409834.
Hs.731711.

Genome annotation databases

EnsembliENST00000247665; ENSP00000247665; ENSG00000054148. [Q9NRX4-1]
ENST00000371661; ENSP00000360724; ENSG00000054148. [Q9NRX4-2]
GeneIDi29085.
KEGGihsa:29085.
UCSCiuc064xew.1. human. [Q9NRX4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF393504 mRNA. Translation: AAN52504.1.
AF164795 mRNA. Translation: AAF80759.1.
AF285119 mRNA. Translation: AAG01156.1.
AL136644 mRNA. Translation: CAB66579.1.
AL355987 Genomic DNA. Translation: CAI12692.1.
AL355987 Genomic DNA. Translation: CAI12693.1.
CH471090 Genomic DNA. Translation: EAW88289.1.
BC024648 mRNA. Translation: AAH24648.1.
BQ922335 mRNA. No translation available.
CCDSiCCDS48060.1. [Q9NRX4-2]
CCDS7009.1. [Q9NRX4-1]
RefSeqiNP_001129333.1. NM_001135861.2. [Q9NRX4-2]
NP_054891.2. NM_014172.5. [Q9NRX4-1]
UniGeneiHs.409834.
Hs.731711.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AI6NMR-A1-125[»]
2HW4X-ray1.90A5-125[»]
2NMMX-ray2.70A/B/C1-125[»]
2OZWNMR-A1-125[»]
2OZXNMR-A1-125[»]
ProteinModelPortaliQ9NRX4.
SMRiQ9NRX4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118854. 19 interactors.
DIPiDIP-48597N.
IntActiQ9NRX4. 3 interactors.
MINTiMINT-1394164.
STRINGi9606.ENSP00000247665.

PTM databases

DEPODiQ9NRX4.
iPTMnetiQ9NRX4.
PhosphoSitePlusiQ9NRX4.

Polymorphism and mutation databases

DMDMi25008934.

Proteomic databases

EPDiQ9NRX4.
PaxDbiQ9NRX4.
PeptideAtlasiQ9NRX4.
PRIDEiQ9NRX4.
TopDownProteomicsiQ9NRX4-1. [Q9NRX4-1]

Protocols and materials databases

DNASUi29085.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000247665; ENSP00000247665; ENSG00000054148. [Q9NRX4-1]
ENST00000371661; ENSP00000360724; ENSG00000054148. [Q9NRX4-2]
GeneIDi29085.
KEGGihsa:29085.
UCSCiuc064xew.1. human. [Q9NRX4-1]

Organism-specific databases

CTDi29085.
DisGeNETi29085.
GeneCardsiPHPT1.
HGNCiHGNC:30033. PHPT1.
HPAiCAB013584.
HPA020952.
MIMi610167. gene.
neXtProtiNX_Q9NRX4.
OpenTargetsiENSG00000054148.
PharmGKBiPA134948141.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZ5G. Eukaryota.
ENOG4111SA6. LUCA.
GeneTreeiENSGT00390000002738.
HOGENOMiHOG000231559.
HOVERGENiHBG053589.
InParanoidiQ9NRX4.
KOiK01112.
OMAiGWAEYHA.
OrthoDBiEOG091G10Y7.
PhylomeDBiQ9NRX4.
TreeFamiTF315158.

Enzyme and pathway databases

BioCyciMetaCyc:ENSG00000054148-MONOMER.

Miscellaneous databases

ChiTaRSiPHPT1. human.
EvolutionaryTraceiQ9NRX4.
GeneWikiiPHPT1.
GenomeRNAii29085.
PROiQ9NRX4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000054148.
CleanExiHS_PHPT1.
ExpressionAtlasiQ9NRX4. baseline and differential.
GenevisibleiQ9NRX4. HS.

Family and domain databases

InterProiIPR007702. Janus.
IPR028441. PHPT1.
[Graphical view]
PANTHERiPTHR12258:SF10. PTHR12258:SF10. 1 hit.
PfamiPF05005. Ocnus. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPHP14_HUMAN
AccessioniPrimary (citable) accession number: Q9NRX4
Secondary accession number(s): B1AMX0, B1AMX1, Q9H0Y3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.