Q9NRX4 (PHP14_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 14 kDa phosphohistidine phosphatase EC=3.1.3.- Alternative name(s): Phosphohistidine phosphatase 1 Protein janus-A homolog | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 125 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Exhibits phosphohistidine phosphatase activity. |
| Subunit structure | Monomer. |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed abundantly in heart and skeletal muscle. |
| Sequence similarities | Belongs to the janus family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRX4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRX4-2) The sequence of this isoform differs from the canonical sequence as follows: 96-125: AYGPAQHAISTEKIKAKYPDYEVTWANDGY → MRPTCVPLGASGPRIHHQGLWSCPARHFN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 125 | 125 | 14 kDa phosphohistidine phosphatase | PRO_0000206152 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Region | 94 – 96 | 3 | Substrate binding | ||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||
| Active site | 53 | 1 | Proton acceptor Ref.12 | ||||||||||||||||||||||||||
| Binding site | 21 | 1 | Substrate | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 93 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||
| Modified residue | 116 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 96 – 125 | 30 | AYGPA…ANDGY → MRPTCVPLGASGPRIHHQGL WSCPARHFN in isoform 2. | VSP_041159 | |||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||
| Mutagenesis | 21 | 1 | K → A: Decreased affinity for substrate and strongly reduced catalytic activity. Ref.12 | ||||||||||||||||||||||||||
| Mutagenesis | 45 | 1 | R → A: Slightly decreased affinity for substrate, but no effect on catalytic activity. Ref.8 Ref.12 | ||||||||||||||||||||||||||
| Mutagenesis | 53 | 1 | H → A: Loss of activity. Ref.8 Ref.12 | ||||||||||||||||||||||||||
| Mutagenesis | 78 | 1 | R → A: Decreased affinity for substrate and reduced catalytic activity. Ref.8 Ref.12 | ||||||||||||||||||||||||||
| Mutagenesis | 94 | 1 | S → A: Decreased affinity for substrate and strongly reduced catalytic activity. | ||||||||||||||||||||||||||
| Mutagenesis | 102 | 1 | H → A: Decreased affinity for substrate and slightly reduced catalytic activity. Ref.8 Ref.12 | ||||||||||||||||||||||||||
| Sequence conflict | 14 | 1 | I → T in CAB66579. Ref.4 | ||||||||||||||||||||||||||
| Sequence conflict | 27 | 1 | V → I in CAB66579. Ref.4 | ||||||||||||||||||||||||||
| Sequence conflict | 79 | 1 | I → T in CAB66579. Ref.4 | ||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Helix | 6 – 8 | 3 | |||||||||||||||||||||||||||
| Beta strand | 11 – 14 | 4 | |||||||||||||||||||||||||||
| Beta strand | 17 – 28 | 12 | |||||||||||||||||||||||||||
| Beta strand | 40 – 46 | 7 | |||||||||||||||||||||||||||
| Helix | 53 – 66 | 14 | |||||||||||||||||||||||||||
| Beta strand | 70 – 82 | 13 | |||||||||||||||||||||||||||
| Turn | 83 – 86 | 4 | |||||||||||||||||||||||||||
| Beta strand | 87 – 91 | 5 | |||||||||||||||||||||||||||
| Turn | 95 – 97 | 3 | |||||||||||||||||||||||||||
| Helix | 102 – 112 | 11 | |||||||||||||||||||||||||||
| Beta strand | 116 – 120 | 5 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a mammalian 14-kDa phosphohistidine phosphatase." Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O. Eur. J. Biochem. 269:5016-5023(2002) [PubMed: 12383260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 2-21; 49-59; 88-108 AND 111-125, CHARACTERIZATION. Tissue: Embryonic kidney. |
| [2] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed: 10931946] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adrenal gland. |
| [3] | "Identification of the human crooked neck gene by comparative gene identification." Lai C.-H., Chiu J.-Y., Lin W.-C. Biochim. Biophys. Acta 1517:449-454(2001) [PubMed: 11342225] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Lung. |
| [8] | "Mutational study of human phosphohistidine phosphatase: effect on enzymatic activity." Ma R., Kanders E., Sundh U.B., Geng M., Ek P., Zetterqvist O., Li J.-P. Biochem. Biophys. Res. Commun. 337:887-891(2005) [PubMed: 16219293] [Abstract] Cited for: MUTAGENESIS OF ARG-45; HIS-53; ARG-78 AND HIS-102. |
| [9] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-116 AND TYR-125, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "First structure of a eukaryotic phosphohistidine phosphatase." Busam R.D., Thorsell A.-G., Flores A., Hammarstroem M., Persson C., Hallberg B.M. J. Biol. Chem. 281:33830-33834(2006) [PubMed: 16990267] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 5-125. |
| [12] | "Solution structure and catalytic mechanism of human protein histidine phosphatase 1." Gong W., Li Y., Cui G., Hu J., Fang H., Jin C., Xia B. Biochem. J. 418:337-344(2009) [PubMed: 18991813] [Abstract] Cited for: STRUCTURE BY NMR IN COMPLEXES WITH PHOSPHATE, ACTIVE SITE, ENZYME ACTIVITY, MUTAGENESIS OF LYS-21; ARG-45; HIS-53; ARG-78 AND HIS-102. |
| [13] | "Crystal structure of human phosphohistidine phosphatase. Northeast structural genomics consortium target HR1409." Northeast structural genomics consortium (NESG) Submitted (JAN-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF393504 mRNA. Translation: AAN52504.1. AF164795 mRNA. Translation: AAF80759.1. AF285119 mRNA. Translation: AAG01156.1. AL136644 mRNA. Translation: CAB66579.1. AL355987 Genomic DNA. Translation: CAI12692.1. AL355987 Genomic DNA. Translation: CAI12693.1. CH471090 Genomic DNA. Translation: EAW88289.1. BC024648 mRNA. Translation: AAH24648.1. BQ922335 mRNA. No translation available. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00299977. IPI00513775. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001129333.1. NM_001135861.1. NP_054891.2. NM_014172.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.409834. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| SMR | Q9NRX4. Positions 1-125. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-48597N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q9NRX4. 2 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1394164. | ||||||||||||||||||||||||||||||||||||
| STRING | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 25008934. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PeptideAtlas | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000247665; ENSP00000247665; ENSG00000054148. | ||||||||||||||||||||||||||||||||||||
| GeneID | 29085. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:29085. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc004cjp.1. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 29085. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P139743. | ||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0008560. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:30033. PHPT1. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB013584. HPA020952. | ||||||||||||||||||||||||||||||||||||
| MIM | 610167. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134948141. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00510000050098. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053589. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PHPT1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9NRX4. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000054148. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR007702. Ocnus. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| KO | K01112. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF05005. Ocnus. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| NextBio | 52068. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PHP14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRX4 Secondary accession number(s): B1AMX0, B1AMX1, Q9H0Y3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with