Q9NRW4 (DUS22_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase 22 EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): JNK-stimulatory phosphatase-1 Short name=JSP-1 Low molecular weight dual specificity phosphatase 2 Short name=LMW-DSP2 Mitogen-activated protein kinase phosphatase x Short name=MAP kinase phosphatase x Short name=MKP-x | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 184 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) By similarity. Ref.1 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Monomer. Ref.9 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. Ref.1 |
| Post-translational modification | Myristoylation regulates subcellular location, and is necessary for activation of JNK. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain. |
| Sequence caution | The sequence AAH16844.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRW4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRW4-2) The sequence of this isoform differs from the canonical sequence as follows: 170-184: AAPGILKFWAFLRRL → GKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||||||||||||||||||||||||||
| Chain | 2 – 184 | 183 | Dual specificity protein phosphatase 22 | PRO_0000244751 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Domain | 65 – 133 | 69 | Tyrosine-protein phosphatase | ||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||
| Active site | 88 | 1 | Phosphocysteine intermediate By similarity | ||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.8 | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 184 | 15 | AAPGI…FLRRL → GKYKEQGRTEPQPGARRWSS FPALAPLTYDNYTTET in isoform 2. | VSP_019614 | |||||||||||||||||||||||||||||||
| Natural variant | 119 | 1 | R → H. Corresponds to variant rs7768224 [ dbSNP | Ensembl ]. | VAR_026912 | |||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 6 – 9 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 12 – 15 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 19 – 21 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 23 – 28 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 31 – 36 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 49 – 52 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 64 – 66 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 67 – 79 | 13 | |||||||||||||||||||||||||||||||||
| Beta strand | 83 – 87 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 89 – 93 | 5 | |||||||||||||||||||||||||||||||||
| Helix | 94 – 105 | 12 | |||||||||||||||||||||||||||||||||
| Helix | 111 – 121 | 11 | |||||||||||||||||||||||||||||||||
| Helix | 129 – 141 | 13 | |||||||||||||||||||||||||||||||||
| Helix | 143 – 153 | 11 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activation of the Jnk signaling pathway by a dual-specificity phosphatase, JSP-1." Shen Y., Luche R., Wei B., Gordon M.L., Diltz C.D., Tonks N.K. Proc. Natl. Acad. Sci. U.S.A. 98:13613-13618(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndromes patient." Gu J., Huang Q., Yu Y., Xu S., Wang Y., Han Z., Chen Z., Zhou J., Tu Y., Gu W., Fu G., Huang C. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hematopoietic stem cell. |
| [3] | "Cloning and characterization of human LMW-DSP2 gene." Mao Y., Xie Y., Cheng H. Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thalamus. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Pancreas. |
| [7] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 56-184 (ISOFORM 2). Tissue: Myeloid. |
| [8] | "Myristoylation of the dual-specificity phosphatase c-JUN N-terminal kinase (JNK) stimulatory phosphatase 1 is necessary for its activation of JNK signaling and apoptosis." Schwertassek U., Buckley D.A., Xu C.F., Lindsay A.J., McCaffrey M.W., Neubert T.A., Tonks N.K. FEBS J. 277:2463-2473(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MYRISTOYLATION AT GLY-2. |
| [9] | "Crystal structure of human dual specificity phosphatase, JNK stimulatory phosphatase-1, at 1.5 A resolution." Yokota T., Nara Y., Kashima A., Matsubara K., Misawa S., Kato R., Sugio S. Proteins 66:272-278(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 1-163, SUBUNIT, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF424702 mRNA. Translation: AAL18850.1. AF165519 mRNA. Translation: AAF86649.1. AY249859 mRNA. Translation: AAP76376.1. AK296402 mRNA. Translation: BAG59068.1. AL365272 Genomic DNA. Translation: CAH72534.1. AL365272 Genomic DNA. Translation: CAH72535.1. BC016844 mRNA. Translation: AAH16844.1. Different initiation. BC022847 mRNA. Translation: AAH22847.1. AB208997 mRNA. Translation: BAD92234.1. | ||||||||||||
| IPI | IPI00024617. IPI00646309. | ||||||||||||
| RefSeq | NP_064570.1. NM_020185.3. | ||||||||||||
| UniGene | Hs.29106. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NRW4. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NRW4. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000345281. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74752929. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9NRW4. | ||||||||||||
| PRIDE | Q9NRW4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 56940. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000344450; ENSP00000345281; ENSG00000112679. | ||||||||||||
| GeneID | 56940. | ||||||||||||
| KEGG | hsa:56940. | ||||||||||||
| UCSC | uc003msx.3. human. uc011dhn.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 56940. | ||||||||||||
| GeneCards | GC06P000292. | ||||||||||||
| HGNC | HGNC:16077. DUSP22. | ||||||||||||
| HPA | HPA031394. | ||||||||||||
| neXtProt | NX_Q9NRW4. | ||||||||||||
| PharmGKB | PA134991025. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG2453. | ||||||||||||
| HOGENOM | HOG000007880. | ||||||||||||
| HOVERGEN | HBG054344. | ||||||||||||
| InParanoid | Q9NRW4. | ||||||||||||
| KO | K04459. | ||||||||||||
| OMA | WLREEYG. | ||||||||||||
| OrthoDB | EOG4RFKT3. | ||||||||||||
| PhylomeDB | Q9NRW4. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q9NRW4. | ||||||||||||
| CleanEx | HS_DUSP22. | ||||||||||||
| Genevestigator | Q9NRW4. | ||||||||||||
| GermOnline | ENSG00000112679. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR020417. Atypical_DUSP. IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR024950. DUSP. IPR000387. Tyr/Dual-sp_Pase. [Graphical view] | ||||||||||||
| PANTHER | PTHR10159. PTHR10159. 1 hit. | ||||||||||||
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01908. ADSPHPHTASE. | ||||||||||||
| SMART | SM00195. DSPc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. False negative. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | Q9NRW4. | ||||||||||||
| ChEMBL | CHEMBL3924. | ||||||||||||
| ChiTaRS | DUSP22. human. | ||||||||||||
| EvolutionaryTrace | Q9NRW4. | ||||||||||||
| GenomeRNAi | 56940. | ||||||||||||
| NextBio | 62505. | ||||||||||||
Entry information
| Entry name | DUS22_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRW4 Secondary accession number(s): B4DK56 Q96AR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
