Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 22

Gene

DUSP22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).By similarity1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei88Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

  • apoptotic process Source: ProtInc
  • cell proliferation Source: ProtInc
  • inactivation of MAPK activity Source: ProtInc
  • multicellular organism development Source: ProtInc
  • negative regulation of T cell activation Source: Ensembl
  • negative regulation of T cell mediated immunity Source: Ensembl
  • negative regulation of T cell receptor signaling pathway Source: Ensembl
  • negative regulation of transcription by RNA polymerase II Source: MGI
  • positive regulation of JNK cascade Source: GO_Central
  • protein dephosphorylation Source: ProtInc
  • regulation of cell proliferation Source: GO_Central
  • transforming growth factor beta receptor signaling pathway Source: GO_Central

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

SABIO-RKiQ9NRW4
SignaLinkiQ9NRW4
SIGNORiQ9NRW4

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 22 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
JNK-stimulatory phosphatase-1
Short name:
JSP-1
Low molecular weight dual specificity phosphatase 2
Short name:
LMW-DSP2
Mitogen-activated protein kinase phosphatase x
Short name:
MAP kinase phosphatase x
Short name:
MKP-x
Gene namesi
Name:DUSP22
Synonyms:JSP1, LMWDSP2, MKPX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000112679.14
HGNCiHGNC:16077 DUSP22
neXtProtiNX_Q9NRW4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi56940
OpenTargetsiENSG00000112679
PharmGKBiPA134991025

Chemistry databases

ChEMBLiCHEMBL3924

Polymorphism and mutation databases

BioMutaiDUSP22
DMDMi74752929

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002447512 – 184Dual specificity protein phosphatase 22Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine1 Publication1
Modified residuei58PhosphoserineCombined sources1

Post-translational modificationi

Myristoylation regulates subcellular location, and is necessary for activation of JNK.1 Publication

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiQ9NRW4
PaxDbiQ9NRW4
PeptideAtlasiQ9NRW4
PRIDEiQ9NRW4

PTM databases

DEPODiQ9NRW4
iPTMnetiQ9NRW4
PhosphoSitePlusiQ9NRW4

Expressioni

Tissue specificityi

Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.1 Publication

Gene expression databases

BgeeiENSG00000112679
CleanExiHS_DUSP22
ExpressionAtlasiQ9NRW4 baseline and differential
GenevisibleiQ9NRW4 HS

Organism-specific databases

HPAiHPA031394

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi121264112 interactors.
IntActiQ9NRW4 6 interactors.
STRINGi9606.ENSP00000345281

Chemistry databases

BindingDBiQ9NRW4

Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 9Combined sources4
Beta strandi12 – 15Combined sources4
Helixi19 – 21Combined sources3
Helixi23 – 28Combined sources6
Beta strandi31 – 38Combined sources8
Beta strandi49 – 54Combined sources6
Helixi64 – 66Combined sources3
Helixi67 – 79Combined sources13
Beta strandi83 – 87Combined sources5
Beta strandi89 – 93Combined sources5
Helixi94 – 106Combined sources13
Helixi111 – 121Combined sources11
Helixi129 – 141Combined sources13
Helixi143 – 154Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WRMX-ray1.50A1-163[»]
4WOHX-ray1.34A1-163[»]
ProteinModelPortaliQ9NRW4
SMRiQ9NRW4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NRW4

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 133Tyrosine-protein phosphataseAdd BLAST69

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000118853
HOGENOMiHOG000007880
HOVERGENiHBG054344
InParanoidiQ9NRW4
KOiK14165
OMAiLFIGNFK
OrthoDBiEOG091G0NE0
PhylomeDBiQ9NRW4
TreeFamiTF105126

Family and domain databases

CDDicd00127 DSPc, 1 hit
Gene3Di3.90.190.101 hit
InterProiView protein in InterPro
IPR020417 Atypical_DUSP
IPR000340 Dual-sp_phosphatase_cat-dom
IPR024950 DUSP
IPR029021 Prot-tyrosine_phosphatase-like
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PANTHERiPTHR10159 PTHR10159, 1 hit
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PRINTSiPR01908 ADSPHPHTASE
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NRW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNGMNKILP GLYIGNFKDA RDAEQLSKNK VTHILSVHDS ARPMLEGVKY
60 70 80 90 100
LCIPAADSPS QNLTRHFKES IKFIHECRLR GESCLVHCLA GVSRSVTLVI
110 120 130 140 150
AYIMTVTDFG WEDALHTVRA GRSCANPNVG FQRQLQEFEK HEVHQYRQWL
160 170 180
KEEYGESPLQ DAEEAKNILA APGILKFWAF LRRL
Length:184
Mass (Da):20,910
Last modified:October 1, 2000 - v1
Checksum:iB3F962A087C2BA20
GO
Isoform 2 (identifier: Q9NRW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-184: AAPGILKFWAFLRRL → GKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET

Show »
Length:205
Mass (Da):23,268
Checksum:i48334A97991FCFF8
GO

Sequence cautioni

The sequence AAH16844 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026912119R → H. Corresponds to variant dbSNP:rs7768224Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019614170 – 184AAPGI…FLRRL → GKYKEQGRTEPQPGARRWSS FPALAPLTYDNYTTET in isoform 2. 2 PublicationsAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF424702 mRNA Translation: AAL18850.1
AF165519 mRNA Translation: AAF86649.1
AY249859 mRNA Translation: AAP76376.1
AK296402 mRNA Translation: BAG59068.1
AL365272 Genomic DNA No translation available.
BC016844 mRNA Translation: AAH16844.1 Different initiation.
BC022847 mRNA Translation: AAH22847.1
AB208997 mRNA Translation: BAD92234.1
CCDSiCCDS4468.1 [Q9NRW4-1]
CCDS69035.1 [Q9NRW4-2]
RefSeqiNP_001273484.1, NM_001286555.1 [Q9NRW4-2]
NP_064570.1, NM_020185.4 [Q9NRW4-1]
UniGeneiHs.29106

Genome annotation databases

EnsembliENST00000344450; ENSP00000345281; ENSG00000112679 [Q9NRW4-1]
ENST00000419235; ENSP00000397459; ENSG00000112679 [Q9NRW4-2]
GeneIDi56940
KEGGihsa:56940
UCSCiuc003msx.5 human [Q9NRW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDUS22_HUMAN
AccessioniPrimary (citable) accession number: Q9NRW4
Secondary accession number(s): B4DK56
, Q59GW2, Q5VWR2, Q96AR1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: October 1, 2000
Last modified: March 28, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome