Reviewed,
UniProtKB/Swiss-Prot Q9NRW4 (DUS22_HUMAN)
Last modified
June 16, 2009.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Dual specificity protein phosphatase 22 EC=3.1.3.48 EC=3.1.3.16 Alternative name(s): JNK-stimulatory phosphatase-1 Short name=JSP-1 Mitogen-activated protein kinase phosphatase x LMW-DSP2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 184 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. Ref.1 |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | apoptosis Traceable author statement. Source: ProtInc cell proliferationTraceable author statement. Source: ProtInc inactivation of MAPK activityTraceable author statement. Source: ProtInc multicellular organismal developmentTraceable author statement. Source: ProtInc protein amino acid dephosphorylationTraceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein tyrosine phosphatase activity Inferred from electronic annotation. Source: EC protein tyrosine/serine/threonine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRW4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRW4-2) The sequence of this isoform differs from the canonical sequence as follows: 170-184: AAPGILKFWAFLRRL → GKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 184 | 184 | Dual specificity protein phosphatase 22 | PRO_0000244751 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Domain | 65 – 133 | 69 | Tyrosine-protein phosphatase | ||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||
| Active site | 88 | 1 | Phosphocysteine intermediate By similarity | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 184 | 15 | AAPGI…FLRRL → GKYKEQGRTEPQPGARRWSS FPALAPLTYDNYTTET in isoform 2. | VSP_019614 | |||||||||||||||||||||||||||||||
| Natural variant | 119 | 1 | R → H: dbSNP rs7768224. | VAR_026912 | |||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 6 – 9 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 12 – 15 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 19 – 21 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 23 – 28 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 31 – 36 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 49 – 52 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 64 – 66 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 67 – 79 | 13 | |||||||||||||||||||||||||||||||||
| Beta strand | 83 – 87 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 89 – 93 | 5 | |||||||||||||||||||||||||||||||||
| Helix | 94 – 105 | 12 | |||||||||||||||||||||||||||||||||
| Helix | 111 – 121 | 11 | |||||||||||||||||||||||||||||||||
| Helix | 129 – 141 | 13 | |||||||||||||||||||||||||||||||||
| Helix | 143 – 153 | 11 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activation of the Jnk signaling pathway by a dual-specificity phosphatase, JSP-1." Shen Y., Luche R., Wei B., Gordon M.L., Diltz C.D., Tonks N.K. Proc. Natl. Acad. Sci. U.S.A. 98:13613-13618(2001) [PubMed: 11717427] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION OF ISOFORM 2, FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndromes patient." Gu J., Huang Q., Yu Y., Xu S., Wang Y., Han Z., Chen Z., Zhou J., Tu Y., Gu W., Fu G., Huang C. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hematopoietic stem cell. |
| [3] | "Cloning and characterization of human LMW-DSP2 gene." Mao Y., Xie Y., Cheng H. Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thalamus. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Pancreas. |
| [7] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 56-184 (ISOFORM 2). Tissue: Myeloid. |
| [8] | "Crystal structure of novel human dual specificity phosphatase, JNK stimulatory phosphatase-1, at 1.5 A resolution." Yokota T., Kashima A., Kato R., Sugio S. Submitted (OCT-2005) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 1-163. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF424702 mRNA. Translation: AAL18850.1. AF165519 mRNA. Translation: AAF86649.1. AY249859 mRNA. Translation: AAP76376.1. AK296402 mRNA. Translation: BAG59068.1. AL365272 Genomic DNA. Translation: CAH72534.1. AL365272 Genomic DNA. Translation: CAH72535.1. BC016844 mRNA. Translation: AAH16844.1. Different initiation. BC022847 mRNA. Translation: AAH22847.1. AB208997 mRNA. Translation: BAD92234.1. | |||||||||||||
| IPI | IPI00024617. IPI00646309. | ||||||||||||
| RefSeq | NP_064570.1. | ||||||||||||
| UniGene | Hs.29106 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NRW4. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000112679. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 56940. | ||||||||||||
| KEGG | hsa:56940. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC06P000237. | ||||||||||||
| H-InvDB | HIX0005513. | ||||||||||||
| HGNC | HGNC:16077. DUSP22. | ||||||||||||
| PharmGKB | PA134991025. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | Q9NRW4. | ||||||||||||
| HOVERGEN | Q9NRW4. | ||||||||||||
| OMA | Q9NRW4. KHEVHQY. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.3.16. 247. 3.1.3.48. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NRW4. | ||||||||||||
| Bgee | Q9NRW4. | ||||||||||||
| CleanEx | HS_DUSP22. | ||||||||||||
| GermOnline | ENSG00000112679. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000387. Tyr_Pase. IPR016130. Tyr_Pase_AS. IPR000340. Tyr_Pase_dual_specific. [Graphical view] | ||||||||||||
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00195. DSPc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. False negative. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 62505. | ||||||||||||
Entry information
| Entry name | DUS22_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRW4 Secondary accession number(s): B4DK56 Q96AR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


