Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 22

Gene

DUSP22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).By similarity1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei88Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

  • apoptotic process Source: ProtInc
  • cell proliferation Source: ProtInc
  • inactivation of MAPK activity Source: ProtInc
  • multicellular organism development Source: ProtInc
  • negative regulation of T cell activation Source: Ensembl
  • negative regulation of T cell mediated immunity Source: Ensembl
  • negative regulation of T cell receptor signaling pathway Source: Ensembl
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • positive regulation of JNK cascade Source: GO_Central
  • protein dephosphorylation Source: ProtInc
  • regulation of cell proliferation Source: GO_Central
  • transforming growth factor beta receptor signaling pathway Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:HS03604-MONOMER.
SABIO-RKQ9NRW4.
SignaLinkiQ9NRW4.
SIGNORiQ9NRW4.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 22 (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
JNK-stimulatory phosphatase-1
Short name:
JSP-1
Low molecular weight dual specificity phosphatase 2
Short name:
LMW-DSP2
Mitogen-activated protein kinase phosphatase x
Short name:
MAP kinase phosphatase x
Short name:
MKP-x
Gene namesi
Name:DUSP22
Synonyms:JSP1, LMWDSP2, MKPX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:16077. DUSP22.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi56940.
OpenTargetsiENSG00000112679.
PharmGKBiPA134991025.

Chemistry databases

ChEMBLiCHEMBL3924.

Polymorphism and mutation databases

BioMutaiDUSP22.
DMDMi74752929.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002447512 – 184Dual specificity protein phosphatase 22Add BLAST183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine1 Publication1
Modified residuei58PhosphoserineCombined sources1

Post-translational modificationi

Myristoylation regulates subcellular location, and is necessary for activation of JNK.1 Publication

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

EPDiQ9NRW4.
MaxQBiQ9NRW4.
PaxDbiQ9NRW4.
PeptideAtlasiQ9NRW4.
PRIDEiQ9NRW4.

PTM databases

DEPODiQ9NRW4.
iPTMnetiQ9NRW4.
PhosphoSitePlusiQ9NRW4.

Expressioni

Tissue specificityi

Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.1 Publication

Gene expression databases

BgeeiENSG00000112679.
CleanExiHS_DUSP22.
ExpressionAtlasiQ9NRW4. baseline and differential.
GenevisibleiQ9NRW4. HS.

Organism-specific databases

HPAiHPA031394.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi121264. 39 interactors.
IntActiQ9NRW4. 1 interactor.
STRINGi9606.ENSP00000345281.

Chemistry databases

BindingDBiQ9NRW4.

Structurei

Secondary structure

1184
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 9Combined sources4
Beta strandi12 – 15Combined sources4
Helixi19 – 21Combined sources3
Helixi23 – 28Combined sources6
Beta strandi31 – 38Combined sources8
Beta strandi49 – 54Combined sources6
Helixi64 – 66Combined sources3
Helixi67 – 79Combined sources13
Beta strandi83 – 87Combined sources5
Beta strandi89 – 93Combined sources5
Helixi94 – 106Combined sources13
Helixi111 – 121Combined sources11
Helixi129 – 141Combined sources13
Helixi143 – 154Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WRMX-ray1.50A1-163[»]
4WOHX-ray1.34A1-163[»]
ProteinModelPortaliQ9NRW4.
SMRiQ9NRW4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NRW4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 133Tyrosine-protein phosphataseAdd BLAST69

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118853.
HOGENOMiHOG000007880.
HOVERGENiHBG054344.
InParanoidiQ9NRW4.
KOiK14165.
OMAiLFIGNFK.
OrthoDBiEOG091G0NE0.
PhylomeDBiQ9NRW4.
TreeFamiTF105126.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NRW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNGMNKILP GLYIGNFKDA RDAEQLSKNK VTHILSVHDS ARPMLEGVKY
60 70 80 90 100
LCIPAADSPS QNLTRHFKES IKFIHECRLR GESCLVHCLA GVSRSVTLVI
110 120 130 140 150
AYIMTVTDFG WEDALHTVRA GRSCANPNVG FQRQLQEFEK HEVHQYRQWL
160 170 180
KEEYGESPLQ DAEEAKNILA APGILKFWAF LRRL
Length:184
Mass (Da):20,910
Last modified:October 1, 2000 - v1
Checksum:iB3F962A087C2BA20
GO
Isoform 2 (identifier: Q9NRW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-184: AAPGILKFWAFLRRL → GKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET

Show »
Length:205
Mass (Da):23,268
Checksum:i48334A97991FCFF8
GO

Sequence cautioni

The sequence AAH16844 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026912119R → H.Corresponds to variant rs7768224dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019614170 – 184AAPGI…FLRRL → GKYKEQGRTEPQPGARRWSS FPALAPLTYDNYTTET in isoform 2. 2 PublicationsAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF424702 mRNA. Translation: AAL18850.1.
AF165519 mRNA. Translation: AAF86649.1.
AY249859 mRNA. Translation: AAP76376.1.
AK296402 mRNA. Translation: BAG59068.1.
AL365272 Genomic DNA. Translation: CAH72534.1.
AL365272 Genomic DNA. Translation: CAH72535.1.
BC016844 mRNA. Translation: AAH16844.1. Different initiation.
BC022847 mRNA. Translation: AAH22847.1.
AB208997 mRNA. Translation: BAD92234.1.
CCDSiCCDS4468.1. [Q9NRW4-1]
CCDS69035.1. [Q9NRW4-2]
RefSeqiNP_001273484.1. NM_001286555.1. [Q9NRW4-2]
NP_064570.1. NM_020185.4. [Q9NRW4-1]
UniGeneiHs.29106.

Genome annotation databases

EnsembliENST00000344450; ENSP00000345281; ENSG00000112679. [Q9NRW4-1]
ENST00000419235; ENSP00000397459; ENSG00000112679. [Q9NRW4-2]
GeneIDi56940.
KEGGihsa:56940.
UCSCiuc003msx.5. human. [Q9NRW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF424702 mRNA. Translation: AAL18850.1.
AF165519 mRNA. Translation: AAF86649.1.
AY249859 mRNA. Translation: AAP76376.1.
AK296402 mRNA. Translation: BAG59068.1.
AL365272 Genomic DNA. Translation: CAH72534.1.
AL365272 Genomic DNA. Translation: CAH72535.1.
BC016844 mRNA. Translation: AAH16844.1. Different initiation.
BC022847 mRNA. Translation: AAH22847.1.
AB208997 mRNA. Translation: BAD92234.1.
CCDSiCCDS4468.1. [Q9NRW4-1]
CCDS69035.1. [Q9NRW4-2]
RefSeqiNP_001273484.1. NM_001286555.1. [Q9NRW4-2]
NP_064570.1. NM_020185.4. [Q9NRW4-1]
UniGeneiHs.29106.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WRMX-ray1.50A1-163[»]
4WOHX-ray1.34A1-163[»]
ProteinModelPortaliQ9NRW4.
SMRiQ9NRW4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121264. 39 interactors.
IntActiQ9NRW4. 1 interactor.
STRINGi9606.ENSP00000345281.

Chemistry databases

BindingDBiQ9NRW4.
ChEMBLiCHEMBL3924.

PTM databases

DEPODiQ9NRW4.
iPTMnetiQ9NRW4.
PhosphoSitePlusiQ9NRW4.

Polymorphism and mutation databases

BioMutaiDUSP22.
DMDMi74752929.

Proteomic databases

EPDiQ9NRW4.
MaxQBiQ9NRW4.
PaxDbiQ9NRW4.
PeptideAtlasiQ9NRW4.
PRIDEiQ9NRW4.

Protocols and materials databases

DNASUi56940.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344450; ENSP00000345281; ENSG00000112679. [Q9NRW4-1]
ENST00000419235; ENSP00000397459; ENSG00000112679. [Q9NRW4-2]
GeneIDi56940.
KEGGihsa:56940.
UCSCiuc003msx.5. human. [Q9NRW4-1]

Organism-specific databases

CTDi56940.
DisGeNETi56940.
GeneCardsiDUSP22.
HGNCiHGNC:16077. DUSP22.
HPAiHPA031394.
neXtProtiNX_Q9NRW4.
OpenTargetsiENSG00000112679.
PharmGKBiPA134991025.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118853.
HOGENOMiHOG000007880.
HOVERGENiHBG054344.
InParanoidiQ9NRW4.
KOiK14165.
OMAiLFIGNFK.
OrthoDBiEOG091G0NE0.
PhylomeDBiQ9NRW4.
TreeFamiTF105126.

Enzyme and pathway databases

BioCyciZFISH:HS03604-MONOMER.
SABIO-RKQ9NRW4.
SignaLinkiQ9NRW4.
SIGNORiQ9NRW4.

Miscellaneous databases

ChiTaRSiDUSP22. human.
EvolutionaryTraceiQ9NRW4.
GeneWikiiDUSP22.
GenomeRNAii56940.
PROiQ9NRW4.

Gene expression databases

BgeeiENSG00000112679.
CleanExiHS_DUSP22.
ExpressionAtlasiQ9NRW4. baseline and differential.
GenevisibleiQ9NRW4. HS.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDUS22_HUMAN
AccessioniPrimary (citable) accession number: Q9NRW4
Secondary accession number(s): B4DK56
, Q59GW2, Q5VWR2, Q96AR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.