Q9NRM0 (GTR9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Solute carrier family 2, facilitated glucose transporter member 9 Alternative name(s): Glucose transporter type 9 Short name=GLUT-9 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 540 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate. Ref.5 Ref.7 |
| Subcellular location | |
| Tissue specificity | Most strongly expressed in basolateral membranes of proximal renal tubular cells, liver and placenta. Also detected in lung, blood leukocytes, heart skeletal muscle and chondrocytes from articular cartilage. Isoform 2 is only detected in the apical membranes of polarized renal tubular cells and placenta. Isoform 1 and isoform 2 are detected in kidney membrane (at protein level). Ref.4 Ref.5 |
| Polymorphism | Genetic variations in SLC2A9 influence the variance in serum uric acid concentrations and define the serum uric acid concentration quantitative trait locus 2 (UAQTL2) [MIM:612076]. Excess serum accumulation of uric acid can lead to the development of gout. |
| Involvement in disease | Hypouricemia renal 2 (RHUC2) [MIM:612076]: A disorder characterized by impaired uric acid reabsorption at the apical membrane of proximal renal tubule cells, and high urinary urate excretion. Patients often appear asymptomatic, but may be subject to exercise-induced acute renal failure, chronic renal dysfunction and nephrolithiasis. |
| Sequence similarities | Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRM0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRM0-2) Also known as: GLUT9deltaN; The sequence of this isoform differs from the canonical sequence as follows: 1-50: MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRK → MKLSKKDRGEDEESDSAKKKL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 540 | 540 | Solute carrier family 2, facilitated glucose transporter member 9 | PRO_0000050378 | |||||
Regions | |||||||||
| Topological domain | 1 – 51 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 52 – 72 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 73 – 107 | 35 | Extracellular Potential | ||||||
| Transmembrane | 108 – 128 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 129 – 140 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 141 – 161 | 21 | Helical; Name=3; Potential | ||||||
| Topological domain | 162 – 171 | 10 | Extracellular Potential | ||||||
| Transmembrane | 172 – 192 | 21 | Helical; Name=4; Potential | ||||||
| Topological domain | 193 – 200 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 201 – 221 | 21 | Helical; Name=5; Potential | ||||||
| Topological domain | 222 – 231 | 10 | Extracellular Potential | ||||||
| Transmembrane | 232 – 252 | 21 | Helical; Name=6; Potential | ||||||
| Topological domain | 253 – 316 | 64 | Cytoplasmic Potential | ||||||
| Transmembrane | 317 – 337 | 21 | Helical; Name=7; Potential | ||||||
| Topological domain | 338 – 354 | 17 | Extracellular Potential | ||||||
| Transmembrane | 355 – 375 | 21 | Helical; Name=8; Potential | ||||||
| Topological domain | 376 – 381 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 382 – 402 | 21 | Helical; Name=9; Potential | ||||||
| Topological domain | 403 – 415 | 13 | Extracellular Potential | ||||||
| Transmembrane | 416 – 436 | 21 | Helical; Name=10; Potential | ||||||
| Topological domain | 437 – 451 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 452 – 472 | 21 | Helical; Name=11; Potential | ||||||
| Topological domain | 473 – 478 | 6 | Extracellular Potential | ||||||
| Transmembrane | 479 – 499 | 21 | Helical; Name=12; Potential | ||||||
| Topological domain | 500 – 540 | 41 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 90 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 50 | 50 | MARKQ…GRRRK → MKLSKKDRGEDEESDSAKKK L in isoform 2. | VSP_034860 | |||||
| Natural variant | 22 | 1 | S → N. Ref.7 | VAR_045648 | |||||
| Natural variant | 25 | 1 | G → R. Ref.1 Ref.3 Corresponds to variant rs2276961 [ dbSNP | Ensembl ]. | VAR_012157 | |||||
| Natural variant | 75 | 1 | L → R in RHUC2; reduced urate transport activity. Ref.10 | VAR_065772 | |||||
| Natural variant | 125 | 1 | T → M in RHUC2; markedly reduced urate transport activity. Ref.11 | VAR_065773 | |||||
| Natural variant | 171 | 1 | R → C in RHUC2; markedly reduced urate transport activity. Ref.11 | VAR_065774 | |||||
| Natural variant | 191 | 1 | E → D. Ref.6 | VAR_045649 | |||||
| Natural variant | 198 | 1 | R → C in RHUC2; markedly reduced urate transport activity. Ref.8 | VAR_065775 | |||||
| Natural variant | 216 | 1 | G → R. Ref.7 | VAR_045650 | |||||
| Natural variant | 275 | 1 | T → M. Ref.7 | VAR_045651 | |||||
| Natural variant | 281 | 1 | D → H. Ref.6 Ref.7 | VAR_045652 | |||||
| Natural variant | 282 | 1 | V → I. Ref.6 Corresponds to variant rs16890979 [ dbSNP | Ensembl ]. | VAR_012158 | |||||
| Natural variant | 294 | 1 | R → H. Corresponds to variant rs3733591 [ dbSNP | Ensembl ]. | VAR_020337 | |||||
| Natural variant | 300 | 1 | R → H. Ref.7 | VAR_045653 | |||||
| Natural variant | 350 | 1 | P → L. Ref.1 Ref.3 Ref.6 Corresponds to variant rs2280205 [ dbSNP | Ensembl ]. | VAR_012159 | |||||
| Natural variant | 380 | 1 | R → W in RHUC2; markedly reduced urate transport activity. Ref.8 | VAR_065776 | |||||
| Isoform 2: | |||||||||
| Natural variant | 17 | 1 | A → T in dbSNP:6820230. | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression analysis of a novel member of the facilitative glucose transporter family, SLC2A9 (GLUT9)." Phay J.E., Hussain H.B., Moley J.F. Genomics 66:217-220(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-25 AND LEU-350. Tissue: Kidney. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ARG-25 AND LEU-350. Tissue: Lung and Ovary. |
| [4] | "Human articular chondrocytes express three facilitative glucose transporter isoforms: GLUT1, GLUT3 and GLUT9." Mobasheri A., Neama G., Bell S., Richardson S., Carter S.D. Cell Biol. Int. 26:297-300(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 85-238 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Articular cartilage. |
| [5] | "Identification and characterization of human glucose transporter-like protein-9 (GLUT9): alternative splicing alters trafficking." Augustin R., Carayannopoulos M.O., Dowd L.O., Phay J.E., Moley J.F., Moley K.H. J. Biol. Chem. 279:16229-16236(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY (ISOFORMS 1 AND 2). |
| [6] | "SLC2A9 influences uric acid concentrations with pronounced sex-specific effects." Doering A., Gieger C., Mehta D., Gohlke H., Prokisch H., Coassin S., Fischer G., Henke K., Klopp N., Kronenberg F., Paulweber B., Pfeufer A., Rosskopf D., Voelzke H., Illig T., Meitinger T., Wichmann H.-E., Meisinger C. Nat. Genet. 40:430-436(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION, VARIANTS ASP-191; HIS-281; ILE-282 AND LEU-350. |
| [7] | "SLC2A9 is a newly identified urate transporter influencing serum urate concentration, urate excretion and gout." Vitart V., Rudan I., Hayward C., Gray N.K., Floyd J., Palmer C.N., Knott S.A., Kolcic I., Polasek O., Graessler J., Wilson J.F., Marinaki A., Riches P.L., Shu X., Janicijevic B., Smolej-Narancic N., Gorgoni B., Morgan J. Wright A.F.Nat. Genet. 40:437-442(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION, FUNCTION, VARIANTS ASN-22; ARG-216; MET-275; HIS-281 AND HIS-300. |
| [8] | "Mutations in glucose transporter 9 gene SLC2A9 cause renal hypouricemia." Matsuo H., Chiba T., Nagamori S., Nakayama A., Domoto H., Phetdee K., Wiriyasermkul P., Kikuchi Y., Oda T., Nishiyama J., Nakamura T., Morimoto Y., Kamakura K., Sakurai Y., Nonoyama S., Kanai Y., Shinomiya N. Am. J. Hum. Genet. 83:744-751(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RHUC2 CYS-198 AND TRP-380, CHARACTERIZATION OF VARIANTS RHUC2 CYS-198 AND TRP-380. |
| [9] | Erratum Matsuo H., Chiba T., Nagamori S., Nakayama A., Domoto H., Phetdee K., Wiriyasermkul P., Kikuchi Y., Oda T., Nishiyama J., Nakamura T., Morimoto Y., Kamakura K., Sakurai Y., Nonoyama S., Kanai Y., Shinomiya N. Am. J. Hum. Genet. 83:795-795(2008) |
| [10] | "Homozygous SLC2A9 mutations cause severe renal hypouricemia." Dinour D., Gray N.K., Campbell S., Shu X., Sawyer L., Richardson W., Rechavi G., Amariglio N., Ganon L., Sela B.A., Bahat H., Goldman M., Weissgarten J., Millar M.R., Wright A.F., Holtzman E.J. J. Am. Soc. Nephrol. 21:64-72(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RHUC2 ARG-75, CHARACTERIZATION OF VARIANT RHUC2 ARG-75. |
| [11] | "Two novel homozygous SLC2A9 mutations cause renal hypouricemia type 2." Dinour D., Gray N.K., Ganon L., Knox A.J., Shalev H., Sela B.A., Campbell S., Sawyer L., Shu X., Valsamidou E., Landau D., Wright A.F., Holtzman E.J. Nephrol. Dial. Transplant. 27:1035-1041(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RHUC2 MET-125 AND CYS-171, CHARACTERIZATION OF VARIANTS RHUC2 MET-125 AND CYS-171. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF210317 mRNA. Translation: AAF85942.1. AC005674 Genomic DNA. No translation available. AC098976 Genomic DNA. No translation available. AC108199 Genomic DNA. Translation: AAY41052.1. BC018897 mRNA. Translation: AAH18897.1. BC110414 mRNA. Translation: AAI10415.1. AF421859 mRNA. Translation: AAL16939.1. |
| IPI | IPI00024031. IPI00163506. |
| RefSeq | NP_001001290.1. NM_001001290.1. NP_064425.2. NM_020041.2. |
| UniGene | Hs.656895. |
3D structure databases | |
| ProteinModelPortal | Q9NRM0. |
| SMR | Q9NRM0. Positions 161-510. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000264784. |
Protein family/group databases | |
| TCDB | 2.A.1.1.72. major facilitator superfamily (MFS). |
PTM databases | |
| PhosphoSite | Q9NRM0. |
Polymorphism databases | |
| DMDM | 300669647. |
Proteomic databases | |
| PaxDb | Q9NRM0. |
| PRIDE | Q9NRM0. |
Protocols and materials databases | |
| DNASU | 56606. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264784; ENSP00000264784; ENSG00000109667. ENST00000309065; ENSP00000311383; ENSG00000109667. ENST00000506583; ENSP00000422209; ENSG00000109667. |
| GeneID | 56606. |
| KEGG | hsa:56606. |
| UCSC | uc003gmc.3. human. uc003gmd.3. human. |
Organism-specific databases | |
| CTD | 56606. |
| GeneCards | GC04M009772. |
| H-InvDB | HIX0004090. |
| HGNC | HGNC:13446. SLC2A9. |
| MIM | 606142. gene. 612076. phenotype. |
| neXtProt | NX_Q9NRM0. |
| Orphanet | 94088. Hereditary renal hypouricemia. |
| PharmGKB | PA37771. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0477. |
| HOGENOM | HOG000202871. |
| HOVERGEN | HBG014816. |
| InParanoid | Q9NRM0. |
| KO | K08146. |
| OMA | VKAFQTF. |
| PhylomeDB | Q9NRM0. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9NRM0. |
| Bgee | Q9NRM0. |
| CleanEx | HS_SLC2A9. |
| Genevestigator | Q9NRM0. |
| GermOnline | ENSG00000109667. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020846. MFS_dom. IPR016196. MFS_dom_general_subst_transpt. IPR005828. Sub_transporter. IPR003663. Sugar/inositol_transpt. IPR005829. Sugar_transporter_CS. [Graphical view] |
| Pfam | PF00083. Sugar_tr. 1 hit. [Graphical view] |
| PRINTS | PR00171. SUGRTRNSPORT. |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| TIGRFAMs | TIGR00879. SP. 1 hit. |
| PROSITE | PS50850. MFS. 1 hit. PS00216. SUGAR_TRANSPORT_1. 1 hit. PS00217. SUGAR_TRANSPORT_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 56606. |
| NextBio | 62053. |
| SOURCE | Search... |
Entry information
| Entry name | GTR9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRM0 Secondary accession number(s): Q0VGC4 Q96P00 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
