Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NRM0

- GTR9_HUMAN

UniProt

Q9NRM0 - GTR9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Solute carrier family 2, facilitated glucose transporter member 9

Gene

SLC2A9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate.2 Publications

GO - Molecular functioni

  1. glucose transmembrane transporter activity Source: Ensembl
  2. sugar:proton symporter activity Source: UniProtKB

GO - Biological processi

  1. glucose transport Source: UniProtKB
  2. proton transport Source: GOC
  3. transmembrane transport Source: Reactome
  4. urate metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Sugar transport, Transport

Enzyme and pathway databases

ReactomeiREACT_19281. Class II GLUTs.

Protein family/group databases

TCDBi2.A.1.1.72. the major facilitator superfamily (mfs).

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 2, facilitated glucose transporter member 9
Alternative name(s):
Glucose transporter type 9
Short name:
GLUT-9
Gene namesi
Name:SLC2A9
Synonyms:GLUT9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:13446. SLC2A9.

Subcellular locationi

Membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5151CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei52 – 7221Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini73 – 10735ExtracellularSequence AnalysisAdd
BLAST
Transmembranei108 – 12821Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini129 – 14012CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei141 – 16121Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini162 – 17110ExtracellularSequence Analysis
Transmembranei172 – 19221Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini193 – 2008CytoplasmicSequence Analysis
Transmembranei201 – 22121Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini222 – 23110ExtracellularSequence Analysis
Transmembranei232 – 25221Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini253 – 31664CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei317 – 33721Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini338 – 35417ExtracellularSequence AnalysisAdd
BLAST
Transmembranei355 – 37521Helical; Name=8Sequence AnalysisAdd
BLAST
Topological domaini376 – 3816CytoplasmicSequence Analysis
Transmembranei382 – 40221Helical; Name=9Sequence AnalysisAdd
BLAST
Topological domaini403 – 41513ExtracellularSequence AnalysisAdd
BLAST
Transmembranei416 – 43621Helical; Name=10Sequence AnalysisAdd
BLAST
Topological domaini437 – 45115CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei452 – 47221Helical; Name=11Sequence AnalysisAdd
BLAST
Topological domaini473 – 4786ExtracellularSequence Analysis
Transmembranei479 – 49921Helical; Name=12Sequence AnalysisAdd
BLAST
Topological domaini500 – 54041CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. integral component of plasma membrane Source: Ensembl
  3. nuclear envelope Source: Ensembl
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Hypouricemia renal 2 (RHUC2) [MIM:612076]: A disorder characterized by impaired uric acid reabsorption at the apical membrane of proximal renal tubule cells, and high urinary urate excretion. Patients often appear asymptomatic, but may be subject to exercise-induced acute renal failure, chronic renal dysfunction and nephrolithiasis.3 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751L → R in RHUC2; reduced urate transport activity. 1 Publication
VAR_065772
Natural varianti125 – 1251T → M in RHUC2; markedly reduced urate transport activity. 1 Publication
Corresponds to variant rs181509591 [ dbSNP | Ensembl ].
VAR_065773
Natural varianti171 – 1711R → C in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065774
Natural varianti198 – 1981R → C in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065775
Natural varianti380 – 3801R → W in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065776

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi612076. phenotype.
Orphaneti94088. Hereditary renal hypouricemia.
PharmGKBiPA37771.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 540540Solute carrier family 2, facilitated glucose transporter member 9PRO_0000050378Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi90 – 901N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9NRM0.
PRIDEiQ9NRM0.

PTM databases

PhosphoSiteiQ9NRM0.

Expressioni

Tissue specificityi

Most strongly expressed in basolateral membranes of proximal renal tubular cells, liver and placenta. Also detected in lung, blood leukocytes, heart skeletal muscle and chondrocytes from articular cartilage. Isoform 2 is only detected in the apical membranes of polarized renal tubular cells and placenta. Isoform 1 and isoform 2 are detected in kidney membrane (at protein level).1 Publication

Gene expression databases

BgeeiQ9NRM0.
CleanExiHS_SLC2A9.
ExpressionAtlasiQ9NRM0. baseline and differential.
GenevestigatoriQ9NRM0.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000264784.

Structurei

3D structure databases

ProteinModelPortaliQ9NRM0.
SMRiQ9NRM0. Positions 57-502.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni327 – 3337Monosaccharide bindingBy similarity

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0477.
GeneTreeiENSGT00760000119022.
HOGENOMiHOG000202871.
HOVERGENiHBG014816.
InParanoidiQ9NRM0.
KOiK08146.
OMAiVKAFQTF.
OrthoDBiEOG7QVM2R.
PhylomeDBiQ9NRM0.
TreeFamiTF313762.

Family and domain databases

InterProiIPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005828. Sub_transporter.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
PRINTSiPR00171. SUGRTRNSPORT.
SUPFAMiSSF103473. SSF103473. 2 hits.
TIGRFAMsiTIGR00879. SP. 1 hit.
PROSITEiPS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NRM0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARKQNRNSK ELGLVPLTDD TSHAGPPGPG RALLECDHLR SGVPGGRRRK
60 70 80 90 100
DWSCSLLVAS LAGAFGSSFL YGYNLSVVNA PTPYIKAFYN ESWERRHGRP
110 120 130 140 150
IDPDTLTLLW SVTVSIFAIG GLVGTLIVKM IGKVLGRKHT LLANNGFAIS
160 170 180 190 200
AALLMACSLQ AGAFEMLIVG RFIMGIDGGV ALSVLPMYLS EISPKEIRGS
210 220 230 240 250
LGQVTAIFIC IGVFTGQLLG LPELLGKEST WPYLFGVIVV PAVVQLLSLP
260 270 280 290 300
FLPDSPRYLL LEKHNEARAV KAFQTFLGKA DVSQEVEEVL AESRVQRSIR
310 320 330 340 350
LVSVLELLRA PYVRWQVVTV IVTMACYQLC GLNAIWFYTN SIFGKAGIPP
360 370 380 390 400
AKIPYVTLST GGIETLAAVF SGLVIEHLGR RPLLIGGFGL MGLFFGTLTI
410 420 430 440 450
TLTLQDHAPW VPYLSIVGIL AIIASFCSGP GGIPFILTGE FFQQSQRPAA
460 470 480 490 500
FIIAGTVNWL SNFAVGLLFP FIQKSLDTYC FLVFATICIT GAIYLYFVLP
510 520 530 540
ETKNRTYAEI SQAFSKRNKA YPPEEKIDSA VTDGKINGRP
Length:540
Mass (Da):58,702
Last modified:July 13, 2010 - v2
Checksum:iEEA40123DB5233B4
GO
Isoform 2 (identifier: Q9NRM0-2) [UniParc]FASTAAdd to Basket

Also known as: GLUT9deltaN

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRK → MKLSKKDRGEDEESDSAKKKL

Show »
Length:511
Mass (Da):55,721
Checksum:iCF8BD02FCBB0BC42
GO

Polymorphismi

Genetic variations in SLC2A9 influence the variance in serum uric acid concentrations and define the serum uric acid concentration quantitative trait locus 2 (UAQTL2) [MIMi:612076]. Excess serum accumulation of uric acid can lead to the development of gout.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti22 – 221S → N.1 Publication
VAR_045648
Natural varianti25 – 251G → R.2 Publications
Corresponds to variant rs2276961 [ dbSNP | Ensembl ].
VAR_012157
Natural varianti75 – 751L → R in RHUC2; reduced urate transport activity. 1 Publication
VAR_065772
Natural varianti125 – 1251T → M in RHUC2; markedly reduced urate transport activity. 1 Publication
Corresponds to variant rs181509591 [ dbSNP | Ensembl ].
VAR_065773
Natural varianti171 – 1711R → C in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065774
Natural varianti191 – 1911E → D.1 Publication
VAR_045649
Natural varianti198 – 1981R → C in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065775
Natural varianti216 – 2161G → R.1 Publication
VAR_045650
Natural varianti275 – 2751T → M.1 Publication
Corresponds to variant rs112404957 [ dbSNP | Ensembl ].
VAR_045651
Natural varianti281 – 2811D → H.2 Publications
Corresponds to variant rs73225891 [ dbSNP | Ensembl ].
VAR_045652
Natural varianti282 – 2821V → I.1 Publication
Corresponds to variant rs16890979 [ dbSNP | Ensembl ].
VAR_012158
Natural varianti294 – 2941R → H.
Corresponds to variant rs3733591 [ dbSNP | Ensembl ].
VAR_020337
Natural varianti300 – 3001R → H.1 Publication
Corresponds to variant rs145688560 [ dbSNP | Ensembl ].
VAR_045653
Natural varianti350 – 3501P → L.3 Publications
Corresponds to variant rs2280205 [ dbSNP | Ensembl ].
VAR_012159
Natural varianti380 – 3801R → W in RHUC2; markedly reduced urate transport activity. 1 Publication
VAR_065776
Isoform 2 (identifier: Q9NRM0-2)
Natural varianti17 – 171A → T in dbSNP:6820230.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MARKQ…GRRRK → MKLSKKDRGEDEESDSAKKK L in isoform 2. 1 PublicationVSP_034860Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF210317 mRNA. Translation: AAF85942.1.
AC005674 Genomic DNA. No translation available.
AC098976 Genomic DNA. No translation available.
AC108199 Genomic DNA. Translation: AAY41052.1.
BC018897 mRNA. Translation: AAH18897.1.
BC110414 mRNA. Translation: AAI10415.1.
AF421859 mRNA. Translation: AAL16939.1.
CCDSiCCDS3406.1. [Q9NRM0-2]
CCDS3407.1. [Q9NRM0-1]
RefSeqiNP_001001290.1. NM_001001290.1. [Q9NRM0-2]
NP_064425.2. NM_020041.2. [Q9NRM0-1]
UniGeneiHs.656895.

Genome annotation databases

EnsembliENST00000264784; ENSP00000264784; ENSG00000109667. [Q9NRM0-1]
ENST00000309065; ENSP00000311383; ENSG00000109667. [Q9NRM0-2]
ENST00000506583; ENSP00000422209; ENSG00000109667. [Q9NRM0-2]
GeneIDi56606.
KEGGihsa:56606.
UCSCiuc003gmc.3. human. [Q9NRM0-1]
uc003gmd.3. human. [Q9NRM0-2]

Polymorphism databases

DMDMi300669647.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF210317 mRNA. Translation: AAF85942.1 .
AC005674 Genomic DNA. No translation available.
AC098976 Genomic DNA. No translation available.
AC108199 Genomic DNA. Translation: AAY41052.1 .
BC018897 mRNA. Translation: AAH18897.1 .
BC110414 mRNA. Translation: AAI10415.1 .
AF421859 mRNA. Translation: AAL16939.1 .
CCDSi CCDS3406.1. [Q9NRM0-2 ]
CCDS3407.1. [Q9NRM0-1 ]
RefSeqi NP_001001290.1. NM_001001290.1. [Q9NRM0-2 ]
NP_064425.2. NM_020041.2. [Q9NRM0-1 ]
UniGenei Hs.656895.

3D structure databases

ProteinModelPortali Q9NRM0.
SMRi Q9NRM0. Positions 57-502.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000264784.

Chemistry

ChEMBLi CHEMBL2052034.
DrugBanki DB00678. Losartan.
DB01032. Probenecid.

Protein family/group databases

TCDBi 2.A.1.1.72. the major facilitator superfamily (mfs).

PTM databases

PhosphoSitei Q9NRM0.

Polymorphism databases

DMDMi 300669647.

Proteomic databases

PaxDbi Q9NRM0.
PRIDEi Q9NRM0.

Protocols and materials databases

DNASUi 56606.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264784 ; ENSP00000264784 ; ENSG00000109667 . [Q9NRM0-1 ]
ENST00000309065 ; ENSP00000311383 ; ENSG00000109667 . [Q9NRM0-2 ]
ENST00000506583 ; ENSP00000422209 ; ENSG00000109667 . [Q9NRM0-2 ]
GeneIDi 56606.
KEGGi hsa:56606.
UCSCi uc003gmc.3. human. [Q9NRM0-1 ]
uc003gmd.3. human. [Q9NRM0-2 ]

Organism-specific databases

CTDi 56606.
GeneCardsi GC04M009772.
H-InvDB HIX0004090.
HGNCi HGNC:13446. SLC2A9.
MIMi 606142. gene.
612076. phenotype.
neXtProti NX_Q9NRM0.
Orphaneti 94088. Hereditary renal hypouricemia.
PharmGKBi PA37771.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0477.
GeneTreei ENSGT00760000119022.
HOGENOMi HOG000202871.
HOVERGENi HBG014816.
InParanoidi Q9NRM0.
KOi K08146.
OMAi VKAFQTF.
OrthoDBi EOG7QVM2R.
PhylomeDBi Q9NRM0.
TreeFami TF313762.

Enzyme and pathway databases

Reactomei REACT_19281. Class II GLUTs.

Miscellaneous databases

GeneWikii SLC2A9.
GenomeRNAii 56606.
NextBioi 62053.
PROi Q9NRM0.
SOURCEi Search...

Gene expression databases

Bgeei Q9NRM0.
CleanExi HS_SLC2A9.
ExpressionAtlasi Q9NRM0. baseline and differential.
Genevestigatori Q9NRM0.

Family and domain databases

InterProi IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR005828. Sub_transporter.
IPR003663. Sugar/inositol_transpt.
IPR005829. Sugar_transporter_CS.
[Graphical view ]
Pfami PF00083. Sugar_tr. 1 hit.
[Graphical view ]
PRINTSi PR00171. SUGRTRNSPORT.
SUPFAMi SSF103473. SSF103473. 2 hits.
TIGRFAMsi TIGR00879. SP. 1 hit.
PROSITEi PS50850. MFS. 1 hit.
PS00216. SUGAR_TRANSPORT_1. 1 hit.
PS00217. SUGAR_TRANSPORT_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression analysis of a novel member of the facilitative glucose transporter family, SLC2A9 (GLUT9)."
    Phay J.E., Hussain H.B., Moley J.F.
    Genomics 66:217-220(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-25 AND LEU-350.
    Tissue: Kidney.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ARG-25 AND LEU-350.
    Tissue: Lung and Ovary.
  4. "Human articular chondrocytes express three facilitative glucose transporter isoforms: GLUT1, GLUT3 and GLUT9."
    Mobasheri A., Neama G., Bell S., Richardson S., Carter S.D.
    Cell Biol. Int. 26:297-300(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 85-238 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Articular cartilage.
  5. "Identification and characterization of human glucose transporter-like protein-9 (GLUT9): alternative splicing alters trafficking."
    Augustin R., Carayannopoulos M.O., Dowd L.O., Phay J.E., Moley J.F., Moley K.H.
    J. Biol. Chem. 279:16229-16236(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY (ISOFORMS 1 AND 2).
  6. Cited for: INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION, VARIANTS ASP-191; HIS-281; ILE-282 AND LEU-350.
  7. Cited for: INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION, FUNCTION, VARIANTS ASN-22; ARG-216; MET-275; HIS-281 AND HIS-300.
  8. Cited for: VARIANTS RHUC2 CYS-198 AND TRP-380, CHARACTERIZATION OF VARIANTS RHUC2 CYS-198 AND TRP-380.
  9. Cited for: VARIANT RHUC2 ARG-75, CHARACTERIZATION OF VARIANT RHUC2 ARG-75.
  10. Cited for: VARIANTS RHUC2 MET-125 AND CYS-171, CHARACTERIZATION OF VARIANTS RHUC2 MET-125 AND CYS-171.

Entry informationi

Entry nameiGTR9_HUMAN
AccessioniPrimary (citable) accession number: Q9NRM0
Secondary accession number(s): Q0VGC4
, Q4W5D1, Q8WV30, Q96P00
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: July 13, 2010
Last modified: October 29, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3