Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NRL3

- STRN4_HUMAN

UniProt

Q9NRL3 - STRN4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Striatin-4

Gene

STRN4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.

GO - Molecular functioni

  1. armadillo repeat domain binding Source: UniProtKB
  2. calmodulin binding Source: UniProtKB
  3. protein complex binding Source: UniProtKB
  4. protein phosphatase 2A binding Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

SignaLinkiF8VYA6.
Q9NRL3.

Names & Taxonomyi

Protein namesi
Recommended name:
Striatin-4
Alternative name(s):
Zinedin
Gene namesi
Name:STRN4
Synonyms:ZIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:15721. STRN4.

Subcellular locationi

Cytoplasm By similarity. Membrane By similarity; Peripheral membrane protein By similarity. Cell projectiondendritic spine By similarity
Note: CTTNBP2-binding may regulate dendritic spine distribution.By similarity

GO - Cellular componenti

  1. cell projection Source: UniProtKB-KW
  2. cytoplasm Source: UniProtKB-KW
  3. membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134863218.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 753753Striatin-4PRO_0000051239Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei53 – 531Phosphoserine2 Publications
Modified residuei206 – 2061Phosphoserine2 Publications
Modified residuei276 – 2761Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NRL3.
PaxDbiQ9NRL3.
PRIDEiQ9NRL3.

PTM databases

PhosphoSiteiQ9NRL3.

Miscellaneous databases

PMAP-CutDBQ9NRL3.

Expressioni

Gene expression databases

BgeeiQ9NRL3.
CleanExiHS_STRN4.
ExpressionAtlasiQ9NRL3. baseline and differential.
GenevestigatoriQ9NRL3.

Organism-specific databases

HPAiHPA043527.
HPA056706.

Interactioni

Subunit structurei

Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN4. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity). Interacts with CTTNBP2NL.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
JUNP054123EBI-717245,EBI-852823

Protein-protein interaction databases

BioGridi118941. 58 interactions.
IntActiQ9NRL3. 54 interactions.
MINTiMINT-1371553.
STRINGi9606.ENSP00000375777.

Structurei

3D structure databases

ProteinModelPortaliQ9NRL3.
SMRiQ9NRL3. Positions 86-130, 425-752.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati436 – 47540WD 1Add
BLAST
Repeati489 – 52840WD 2Add
BLAST
Repeati542 – 58140WD 3Add
BLAST
Repeati587 – 62842WD 4Add
BLAST
Repeati635 – 67440WD 5Add
BLAST
Repeati677 – 71640WD 6Add
BLAST
Repeati723 – 75230WD 7Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni71 – 799Caveolin-bindingSequence Analysis
Regioni165 – 18218Calmodulin-bindingSequence AnalysisAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili69 – 13668Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi6 – 149Poly-Ala

Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00520000055597.
HOGENOMiHOG000236343.
HOVERGENiHBG007117.
InParanoidiQ9NRL3.
KOiK17608.
OMAiYDNYDPG.
OrthoDBiEOG79KPDR.
PhylomeDBiQ9NRL3.
TreeFamiTF313387.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08232. Striatin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NRL3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEERAAAAV AAAASSCRPL GSGAGPGPTG AAPVSAPAPG PGPAGKGGGG
60 70 80 90 100
GGSPGPTAGP EPLSLPGILH FIQHEWARFE AEKARWEAER AELQAQVAFL
110 120 130 140 150
QGERKGQENL KTDLVRRIKM LEYALKQERA KYHKLKFGTD LNQGEKKADV
160 170 180 190 200
SEQVSNGPVE SVTLENSPLV WKEGRQLLRQ YLEEVGYTDT ILDMRSKRVR
210 220 230 240 250
SLLGRSLELN GAVEPSEGAP RAPPGPAGLS GGESLLVKQI EEQIKRNAAG
260 270 280 290 300
KDGKERLGGS VLGQIPFLQN CEDEDSDEDD ELDSVQHKKQ RVKLPSKALV
310 320 330 340 350
PEMEDEDEED DSEDAINEFD FLGSGEDGEG APDPRRCTVD GSPHELESRR
360 370 380 390 400
VKLQGILADL RDVDGLPPKV TGPPPGTPQP RPHEDVFIMD TIGGGEVSLG
410 420 430 440 450
DLADLTVTND NDLSCDLSDS KDAFKKTWNP KFTLRSHYDG IRSLAFHHSQ
460 470 480 490 500
SALLTASEDG TLKLWNLQKA VTAKKNAALD VEPIHAFRAH RGPVLAVAMG
510 520 530 540 550
SNSEYCYSGG ADACIHSWKI PDLSMDPYDG YDPSVLSHVL EGHGDAVWGL
560 570 580 590 600
AFSPTSQRLA SCSADGTVRI WDPSSSSPAC LCTFPTASEH GVPTSVAFTS
610 620 630 640 650
TEPAHIVASF RSGDTVLYDM EVGSALLTLE SRGSSGPTQI NQVVSHPNQP
660 670 680 690 700
LTITAHDDRG IRFLDNRTGK PVHSMVAHLD AVTCLAVDPN GAFLMSGSHD
710 720 730 740 750
CSLRLWSLDN KTCVQEITAH RKKHEEAIHA VACHPSKALI ASAGADALAK

VFV
Length:753
Mass (Da):80,596
Last modified:July 10, 2007 - v2
Checksum:i339AC24E26A9CD54
GO
Isoform 2 (identifier: Q9NRL3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     347-376: ESRRVKLQGILADLRDVDGLPPKVTGPPPG → GPELHSPTEWQGALSVGKASPMPDWVGTAG
     377-753: Missing.

Note: No experimental confirmation available.

Show »
Length:257
Mass (Da):28,106
Checksum:iA3898671C11A1A4C
GO
Isoform 3 (identifier: Q9NRL3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     384-384: E → EGSFGFSS

Show »
Length:760
Mass (Da):81,266
Checksum:i653E59DBCD215E42
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti356 – 3561I → V in AAF29527. (PubMed:10748158)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti568 – 5681V → I.
Corresponds to variant rs10409124 [ dbSNP | Ensembl ].
VAR_053419

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 119119Missing in isoform 2. 1 PublicationVSP_056170Add
BLAST
Alternative sequencei347 – 37630ESRRV…GPPPG → GPELHSPTEWQGALSVGKAS PMPDWVGTAG in isoform 2. 1 PublicationVSP_056171Add
BLAST
Alternative sequencei377 – 753377Missing in isoform 2. 1 PublicationVSP_056172Add
BLAST
Alternative sequencei384 – 3841E → EGSFGFSS in isoform 3. CuratedVSP_056738

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF212940 mRNA. Translation: AAF29527.1.
AK298804 mRNA. Translation: BAG60939.1.
AC008622 Genomic DNA. No translation available.
AC008635 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57442.1.
CH471126 Genomic DNA. Translation: EAW57443.1.
BC004910 mRNA. Translation: AAH04910.2.
BC034604 mRNA. Translation: AAH34604.1.
CCDSiCCDS12690.1. [Q9NRL3-1]
RefSeqiNP_001034966.1. NM_001039877.1.
NP_037535.2. NM_013403.2.
UniGeneiHs.631590.

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372. [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372. [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372. [Q9NRL3-2]
GeneIDi29888.
KEGGihsa:29888.
UCSCiuc002pfl.3. human. [Q9NRL3-1]

Polymorphism databases

DMDMi152031693.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF212940 mRNA. Translation: AAF29527.1 .
AK298804 mRNA. Translation: BAG60939.1 .
AC008622 Genomic DNA. No translation available.
AC008635 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57442.1 .
CH471126 Genomic DNA. Translation: EAW57443.1 .
BC004910 mRNA. Translation: AAH04910.2 .
BC034604 mRNA. Translation: AAH34604.1 .
CCDSi CCDS12690.1. [Q9NRL3-1 ]
RefSeqi NP_001034966.1. NM_001039877.1.
NP_037535.2. NM_013403.2.
UniGenei Hs.631590.

3D structure databases

ProteinModelPortali Q9NRL3.
SMRi Q9NRL3. Positions 86-130, 425-752.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118941. 58 interactions.
IntActi Q9NRL3. 54 interactions.
MINTi MINT-1371553.
STRINGi 9606.ENSP00000375777.

PTM databases

PhosphoSitei Q9NRL3.

Polymorphism databases

DMDMi 152031693.

Proteomic databases

MaxQBi Q9NRL3.
PaxDbi Q9NRL3.
PRIDEi Q9NRL3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263280 ; ENSP00000263280 ; ENSG00000090372 . [Q9NRL3-1 ]
ENST00000391910 ; ENSP00000375777 ; ENSG00000090372 . [Q9NRL3-3 ]
ENST00000435164 ; ENSP00000473607 ; ENSG00000090372 . [Q9NRL3-2 ]
GeneIDi 29888.
KEGGi hsa:29888.
UCSCi uc002pfl.3. human. [Q9NRL3-1 ]

Organism-specific databases

CTDi 29888.
GeneCardsi GC19M047222.
H-InvDB HIX0096898.
HGNCi HGNC:15721. STRN4.
HPAi HPA043527.
HPA056706.
MIMi 614767. gene.
neXtProti NX_Q9NRL3.
PharmGKBi PA134863218.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00520000055597.
HOGENOMi HOG000236343.
HOVERGENi HBG007117.
InParanoidi Q9NRL3.
KOi K17608.
OMAi YDNYDPG.
OrthoDBi EOG79KPDR.
PhylomeDBi Q9NRL3.
TreeFami TF313387.

Enzyme and pathway databases

SignaLinki F8VYA6.
Q9NRL3.

Miscellaneous databases

ChiTaRSi STRN4. human.
GeneWikii STRN4.
GenomeRNAii 29888.
NextBioi 35474140.
PMAP-CutDB Q9NRL3.
PROi Q9NRL3.
SOURCEi Search...

Gene expression databases

Bgeei Q9NRL3.
CleanExi HS_STRN4.
ExpressionAtlasi Q9NRL3. baseline and differential.
Genevestigatori Q9NRL3.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF08232. Striatin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view ]
PRINTSi PR00320. GPROTEINBRPT.
SMARTi SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Zinedin, SG2NA, and striatin are calmodulin-binding, WD repeat proteins principally expressed in the brain."
    Castets F., Rakitina T., Gaillard S., Moqrich A., Mattei M.-G., Monneron A.
    J. Biol. Chem. 275:19970-19977(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Testis.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-276, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein."
    Goudreault M., D'Ambrosio L.M., Kean M.J., Mullin M.J., Larsen B.G., Sanchez A., Chaudhry S., Chen G.I., Sicheri F., Nesvizhskii A.I., Aebersold R., Raught B., Gingras A.C.
    Mol. Cell. Proteomics 8:157-171(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CTTNBP2NL.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-206, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-53 AND SER-206, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-53, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSTRN4_HUMAN
AccessioniPrimary (citable) accession number: Q9NRL3
Secondary accession number(s): A0A024R0V2
, B4DQH7, F8VYA6, Q8NE53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: July 10, 2007
Last modified: October 29, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The name 'Zinedin' probably originates from the name of the famous soccer player from Marseille (Zinedine Zidane).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3