Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Striatin-4

Gene

STRN4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.

GO - Molecular functioni

  • armadillo repeat domain binding Source: UniProtKB
  • calmodulin binding Source: UniProtKB
  • protein complex binding Source: UniProtKB
  • protein phosphatase 2A binding Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000090372-MONOMER.
SignaLinkiQ9NRL3.

Names & Taxonomyi

Protein namesi
Recommended name:
Striatin-4
Alternative name(s):
Zinedin
Gene namesi
Name:STRN4
Synonyms:ZIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:15721. STRN4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi29888.
OpenTargetsiENSG00000090372.
PharmGKBiPA134863218.

Polymorphism and mutation databases

BioMutaiSTRN4.
DMDMi152031693.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512391 – 753Striatin-4Add BLAST753

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei53PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei276PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NRL3.
MaxQBiQ9NRL3.
PaxDbiQ9NRL3.
PeptideAtlasiQ9NRL3.
PRIDEiQ9NRL3.

PTM databases

iPTMnetiQ9NRL3.
PhosphoSitePlusiQ9NRL3.

Miscellaneous databases

PMAP-CutDBQ9NRL3.

Expressioni

Gene expression databases

BgeeiENSG00000090372.
CleanExiHS_STRN4.
ExpressionAtlasiQ9NRL3. baseline and differential.
GenevisibleiQ9NRL3. HS.

Organism-specific databases

HPAiHPA043051.
HPA043527.
HPA056706.

Interactioni

Subunit structurei

Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN4. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity). Interacts with CTTNBP2NL.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
JUNP054123EBI-717245,EBI-852823

GO - Molecular functioni

  • armadillo repeat domain binding Source: UniProtKB
  • calmodulin binding Source: UniProtKB
  • protein complex binding Source: UniProtKB
  • protein phosphatase 2A binding Source: UniProtKB

Protein-protein interaction databases

BioGridi118941. 80 interactors.
IntActiQ9NRL3. 62 interactors.
MINTiMINT-1371553.
STRINGi9606.ENSP00000375777.

Structurei

3D structure databases

ProteinModelPortaliQ9NRL3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati436 – 475WD 1Add BLAST40
Repeati489 – 528WD 2Add BLAST40
Repeati542 – 581WD 3Add BLAST40
Repeati587 – 628WD 4Add BLAST42
Repeati635 – 674WD 5Add BLAST40
Repeati677 – 716WD 6Add BLAST40
Repeati723 – 752WD 7Add BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni71 – 79Caveolin-bindingSequence analysis9
Regioni165 – 182Calmodulin-bindingSequence analysisAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili69 – 136Sequence analysisAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi6 – 14Poly-Ala9

Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0642. Eukaryota.
ENOG410XR31. LUCA.
GeneTreeiENSGT00520000055597.
HOGENOMiHOG000236343.
HOVERGENiHBG007117.
InParanoidiQ9NRL3.
KOiK17608.
OMAiEDDFQGM.
OrthoDBiEOG091G0509.
PhylomeDBiQ9NRL3.
TreeFamiTF313387.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08232. Striatin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NRL3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEERAAAAV AAAASSCRPL GSGAGPGPTG AAPVSAPAPG PGPAGKGGGG
60 70 80 90 100
GGSPGPTAGP EPLSLPGILH FIQHEWARFE AEKARWEAER AELQAQVAFL
110 120 130 140 150
QGERKGQENL KTDLVRRIKM LEYALKQERA KYHKLKFGTD LNQGEKKADV
160 170 180 190 200
SEQVSNGPVE SVTLENSPLV WKEGRQLLRQ YLEEVGYTDT ILDMRSKRVR
210 220 230 240 250
SLLGRSLELN GAVEPSEGAP RAPPGPAGLS GGESLLVKQI EEQIKRNAAG
260 270 280 290 300
KDGKERLGGS VLGQIPFLQN CEDEDSDEDD ELDSVQHKKQ RVKLPSKALV
310 320 330 340 350
PEMEDEDEED DSEDAINEFD FLGSGEDGEG APDPRRCTVD GSPHELESRR
360 370 380 390 400
VKLQGILADL RDVDGLPPKV TGPPPGTPQP RPHEDVFIMD TIGGGEVSLG
410 420 430 440 450
DLADLTVTND NDLSCDLSDS KDAFKKTWNP KFTLRSHYDG IRSLAFHHSQ
460 470 480 490 500
SALLTASEDG TLKLWNLQKA VTAKKNAALD VEPIHAFRAH RGPVLAVAMG
510 520 530 540 550
SNSEYCYSGG ADACIHSWKI PDLSMDPYDG YDPSVLSHVL EGHGDAVWGL
560 570 580 590 600
AFSPTSQRLA SCSADGTVRI WDPSSSSPAC LCTFPTASEH GVPTSVAFTS
610 620 630 640 650
TEPAHIVASF RSGDTVLYDM EVGSALLTLE SRGSSGPTQI NQVVSHPNQP
660 670 680 690 700
LTITAHDDRG IRFLDNRTGK PVHSMVAHLD AVTCLAVDPN GAFLMSGSHD
710 720 730 740 750
CSLRLWSLDN KTCVQEITAH RKKHEEAIHA VACHPSKALI ASAGADALAK

VFV
Length:753
Mass (Da):80,596
Last modified:July 10, 2007 - v2
Checksum:i339AC24E26A9CD54
GO
Isoform 2 (identifier: Q9NRL3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     347-376: ESRRVKLQGILADLRDVDGLPPKVTGPPPG → GPELHSPTEWQGALSVGKASPMPDWVGTAG
     377-753: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):28,106
Checksum:iA3898671C11A1A4C
GO
Isoform 3 (identifier: Q9NRL3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     384-384: E → EGSFGFSS

Show »
Length:760
Mass (Da):81,266
Checksum:i653E59DBCD215E42
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti356I → V in AAF29527 (PubMed:10748158).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053419568V → I.Corresponds to variant rs10409124dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0561701 – 119Missing in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_056171347 – 376ESRRV…GPPPG → GPELHSPTEWQGALSVGKAS PMPDWVGTAG in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_056172377 – 753Missing in isoform 2. 1 PublicationAdd BLAST377
Alternative sequenceiVSP_056738384E → EGSFGFSS in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212940 mRNA. Translation: AAF29527.1.
AK298804 mRNA. Translation: BAG60939.1.
AC008622 Genomic DNA. No translation available.
AC008635 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57442.1.
CH471126 Genomic DNA. Translation: EAW57443.1.
BC004910 mRNA. Translation: AAH04910.2.
BC034604 mRNA. Translation: AAH34604.1.
CCDSiCCDS12690.1. [Q9NRL3-1]
CCDS42581.1. [Q9NRL3-3]
RefSeqiNP_001034966.1. NM_001039877.1. [Q9NRL3-3]
NP_037535.2. NM_013403.2. [Q9NRL3-1]
UniGeneiHs.631590.

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372. [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372. [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372. [Q9NRL3-2]
GeneIDi29888.
KEGGihsa:29888.
UCSCiuc002pfl.4. human. [Q9NRL3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212940 mRNA. Translation: AAF29527.1.
AK298804 mRNA. Translation: BAG60939.1.
AC008622 Genomic DNA. No translation available.
AC008635 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57442.1.
CH471126 Genomic DNA. Translation: EAW57443.1.
BC004910 mRNA. Translation: AAH04910.2.
BC034604 mRNA. Translation: AAH34604.1.
CCDSiCCDS12690.1. [Q9NRL3-1]
CCDS42581.1. [Q9NRL3-3]
RefSeqiNP_001034966.1. NM_001039877.1. [Q9NRL3-3]
NP_037535.2. NM_013403.2. [Q9NRL3-1]
UniGeneiHs.631590.

3D structure databases

ProteinModelPortaliQ9NRL3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118941. 80 interactors.
IntActiQ9NRL3. 62 interactors.
MINTiMINT-1371553.
STRINGi9606.ENSP00000375777.

PTM databases

iPTMnetiQ9NRL3.
PhosphoSitePlusiQ9NRL3.

Polymorphism and mutation databases

BioMutaiSTRN4.
DMDMi152031693.

Proteomic databases

EPDiQ9NRL3.
MaxQBiQ9NRL3.
PaxDbiQ9NRL3.
PeptideAtlasiQ9NRL3.
PRIDEiQ9NRL3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372. [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372. [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372. [Q9NRL3-2]
GeneIDi29888.
KEGGihsa:29888.
UCSCiuc002pfl.4. human. [Q9NRL3-1]

Organism-specific databases

CTDi29888.
DisGeNETi29888.
GeneCardsiSTRN4.
H-InvDBHIX0096898.
HGNCiHGNC:15721. STRN4.
HPAiHPA043051.
HPA043527.
HPA056706.
MIMi614767. gene.
neXtProtiNX_Q9NRL3.
OpenTargetsiENSG00000090372.
PharmGKBiPA134863218.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0642. Eukaryota.
ENOG410XR31. LUCA.
GeneTreeiENSGT00520000055597.
HOGENOMiHOG000236343.
HOVERGENiHBG007117.
InParanoidiQ9NRL3.
KOiK17608.
OMAiEDDFQGM.
OrthoDBiEOG091G0509.
PhylomeDBiQ9NRL3.
TreeFamiTF313387.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000090372-MONOMER.
SignaLinkiQ9NRL3.

Miscellaneous databases

ChiTaRSiSTRN4. human.
GeneWikiiSTRN4.
GenomeRNAii29888.
PMAP-CutDBQ9NRL3.
PROiQ9NRL3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000090372.
CleanExiHS_STRN4.
ExpressionAtlasiQ9NRL3. baseline and differential.
GenevisibleiQ9NRL3. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR013258. Striatin_N.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08232. Striatin. 1 hit.
PF00400. WD40. 4 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 4 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTRN4_HUMAN
AccessioniPrimary (citable) accession number: Q9NRL3
Secondary accession number(s): A0A024R0V2
, B4DQH7, F8VYA6, Q8NE53
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: July 10, 2007
Last modified: November 2, 2016
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The name 'Zinedin' probably originates from the name of the famous soccer player from Marseille (Zinedine Zidane).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.