Q9NRI5 (DISC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disrupted in schizophrenia 1 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 854 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation. Ref.17 Ref.18 Ref.19 |
| Subunit structure | Interacts with NDEL1. Interacts with CCDC88A (via C-terminus); the interaction is direct. Interacts with GSK3B By similarity. Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, NDEL1, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1. Interacts (via C-terminal) with PCNT. Interacts with CHCHD6. Ref.7 Ref.9 Ref.12 Ref.16 Ref.17 Ref.20 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › centrosome. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Note: Colocalizes with NDEL1 in the perinuclear region and the centrosome By similarity. Localizes to punctate cytoplasmic foci which overlap in part with mitochondria. Colocalizes with PCNT at the centrosome. Ref.7 Ref.9 Ref.12 Ref.13 Ref.17 |
| Tissue specificity | Ubiquitous. Highly expressed in the dentate gyrus of the hippocampus. Also expressed in the temporal and parahippocampal cortices and cells of the white matter. Ref.15 |
| Developmental stage | Expression rises within the dentate gyrus and temporal cortex from the neonatal period to infancy, declines markedly in adolescence, and declines further with aging. Ref.15 |
| Involvement in disease | A chromosomal aberration involving DISC1 segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Translocation t(1;11)(q42.1;q14.3). The truncated DISC1 protein produced by this translocation is unable to interact with ATF4, ATF5 and NDEL1. Schizophrenia 9 (SCZD9) [MIM:604906]: A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. |
| Sequence caution | The sequence BAA32302.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAH70955.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI15677.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI17204.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI21886.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI22543.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI23013.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ACTN2 | P35609 | 3 | EBI-529989,EBI-77797 | |
| ANKHD1 | Q8IWZ3-1 | 6 | EBI-529989,EBI-1785446 | |
| ATF4 | P18848 | 3 | EBI-529989,EBI-492498 | |
| ATF5 | Q9Y2D1 | 8 | EBI-529989,EBI-492509 | |
| ATF7IP | Q6VMQ6 | 3 | EBI-529989,EBI-928732 | |
| CCDC141 | Q6ZP82 | 5 | EBI-529989,EBI-928795 | |
| CEP63 | Q96MT8 | 7 | EBI-529989,EBI-741977 | |
| CLU | P10909 | 4 | EBI-529989,EBI-1104674 | |
| COL6A2 | P12110 | 3 | EBI-529989,EBI-928749 | |
| DCTN2 | Q13561 | 3 | EBI-529989,EBI-715074 | |
| DST | Q03001 | 5 | EBI-529989,EBI-310758 | |
| DYNC1H1 | Q14204 | 3 | EBI-529989,EBI-356015 | |
| EIF3H | O15372 | 8 | EBI-529989,EBI-709735 | |
| ITSN1 | Q15811 | 3 | EBI-529989,EBI-602041 | |
| KIF3A | Q9Y496 | 3 | EBI-529989,EBI-1104844 | |
| MACF1 | Q9UPN3 | 5 | EBI-529989,EBI-522925 | |
| MAP1A | P78559 | 3 | EBI-529989,EBI-929047 | |
| NDEL1 | Q9GZM8 | 13 | EBI-529989,EBI-928842 | |
| OLFM1 | Q99784 | 3 | EBI-529989,EBI-1105073 | |
| PCNT | O95613 | 5 | EBI-529989,EBI-530012 | |
| RANBP9 | Q96S59 | 6 | EBI-529989,EBI-636085 | |
| SPTBN1 | Q01082 | 3 | EBI-529989,EBI-351561 | |
| SPTBN4 | Q9H254 | 3 | EBI-529989,EBI-308543 | |
| SYNE1 | Q8NF91 | 6 | EBI-529989,EBI-928867 | |
| TRAF3IP1 | Q8TDR0 | 10 | EBI-529989,EBI-928811 | |
| TRIO | O75962 | 3 | EBI-529989,EBI-718519 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. More than 50 different isoforms are produced in the brain. | ||||||
| Isoform 1 (identifier: Q9NRI5-1) Also known as: L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRI5-2) Also known as: LV; The sequence of this isoform differs from the canonical sequence as follows: 748-769: Missing. | ||||||
| Isoform 3 (identifier: Q9NRI5-3) Also known as: S; The sequence of this isoform differs from the canonical sequence as follows: 661-678: ETSVKENTMKYMETLKNK → GYKYCDAESWTQRSQQLA 679-854: Missing. | ||||||
| Isoform 4 (identifier: Q9NRI5-4) Also known as: ES; The sequence of this isoform differs from the canonical sequence as follows: 350-369: VISLRLKLQKLQEDAVENDD → LEPIALDPPWKPRHPEPNSY 370-854: Missing. | ||||||
| Isoform 5 (identifier: Q9NRI5-5) Also known as: 26; The sequence of this isoform differs from the canonical sequence as follows: 661-854: ETSVKENTMK...MTAGVHEAQA → DGVSLCRPVW...DMSHCAWPLQ | ||||||
| Isoform 6 (identifier: Q9NRI5-6) The sequence of this isoform differs from the canonical sequence as follows: 564-579: VCMSEKFCSTLRKKVN → ETISGRLKTSPRRLDH 580-854: Missing. | ||||||
| Isoform 7 (identifier: Q9NRI5-7) The sequence of this isoform differs from the canonical sequence as follows: 545-559: SLQERIKSLNLSLKE → RNKCEGKYYEVHGNT 560-579: Missing. 580-854: Missing. | ||||||
| Isoform 8 (identifier: Q9NRI5-8) The sequence of this isoform differs from the canonical sequence as follows: 661-695: ETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADL → AASVHCLGKCGKLTWKLVDCLSRAYSSRKPGEACL 696-854: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 854 | 854 | Disrupted in schizophrenia 1 protein | PRO_0000079916 | |||||
Regions | |||||||||
| Region | 1 – 292 | 292 | Interaction with MAP1A | ||||||
| Region | 293 – 696 | 404 | Interaction with TRAF3IP1 | ||||||
| Region | 440 – 597 | 158 | Required for localization to punctate cytoplasmic foci | ||||||
| Region | 446 – 854 | 409 | Necessary and sufficient for interaction with PCNT and localization at the centrosome | ||||||
| Region | 598 – 854 | 257 | Interaction with ATF4 and ATF5 | ||||||
| Region | 727 – 854 | 128 | Interaction with PAFAH1B1 | ||||||
| Region | 802 – 835 | 34 | Interaction with NDEL1 | ||||||
| Coiled coil | 366 – 394 | 29 | Potential | ||||||
| Coiled coil | 452 – 505 | 54 | Potential | ||||||
| Coiled coil | 602 – 666 | 65 | Potential | ||||||
| Coiled coil | 802 – 830 | 29 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 350 – 369 | 20 | VISLR…VENDD → LEPIALDPPWKPRHPEPNSY in isoform 4. | VSP_019314 | |||||
| Alternative sequence | 370 – 854 | 485 | Missing in isoform 4. | VSP_019315 | |||||
| Alternative sequence | 545 – 559 | 15 | SLQER…LSLKE → RNKCEGKYYEVHGNT in isoform 7. | VSP_043583 | |||||
| Alternative sequence | 560 – 579 | 20 | Missing in isoform 7. | VSP_043584 | |||||
| Alternative sequence | 564 – 579 | 16 | VCMSE…RKKVN → ETISGRLKTSPRRLDH in isoform 6. | VSP_043585 | |||||
| Alternative sequence | 580 – 854 | 275 | Missing in isoform 6 and isoform 7. | VSP_043586 | |||||
| Alternative sequence | 661 – 854 | 194 | ETSVK…HEAQA → DGVSLCRPVWSAVVRSCSLQ PLPPEFKQFSCLSLRSSWDY RCPPPCLANFVFLVEMGFYH VDQTGLKLLTSSDPPSSASQ SAGITDMSHCAWPLQ in isoform 5. | VSP_043214 | |||||
| Alternative sequence | 661 – 695 | 35 | ETSVK…WEADL → AASVHCLGKCGKLTWKLVDC LSRAYSSRKPGEACL in isoform 8. | VSP_043587 | |||||
| Alternative sequence | 661 – 678 | 18 | ETSVK…TLKNK → GYKYCDAESWTQRSQQLA in isoform 3. | VSP_019316 | |||||
| Alternative sequence | 679 – 854 | 176 | Missing in isoform 3. | VSP_019317 | |||||
| Alternative sequence | 696 – 854 | 159 | Missing in isoform 8. | VSP_043588 | |||||
| Alternative sequence | 748 – 769 | 22 | Missing in isoform 2. | VSP_003849 | |||||
| Natural variant | 5 | 1 | G → V. Ref.11 Corresponds to variant rs3738400 [ dbSNP | Ensembl ]. | VAR_030422 | |||||
| Natural variant | 116 | 1 | A → V. Corresponds to variant rs56020408 [ dbSNP | Ensembl ]. | VAR_061642 | |||||
| Natural variant | 264 | 1 | R → Q. Ref.1 Ref.2 Ref.3 Corresponds to variant rs3738401 [ dbSNP | Ensembl ]. | VAR_022437 | |||||
| Natural variant | 328 | 1 | T → N. Corresponds to variant rs55795950 [ dbSNP | Ensembl ]. | VAR_061643 | |||||
| Natural variant | 330 | 1 | L → F. Corresponds to variant rs34622148 [ dbSNP | Ensembl ]. | VAR_050954 | |||||
| Natural variant | 531 | 1 | G → R. Corresponds to variant rs56229136 [ dbSNP | Ensembl ]. | VAR_061644 | |||||
| Natural variant | 607 | 1 | L → F Associated with susceptibility to schizoaffective disorder. Ref.11 Corresponds to variant rs6675281 [ dbSNP | Ensembl ]. | VAR_026704 | |||||
| Natural variant | 704 | 1 | S → C. Ref.1 Ref.14 Corresponds to variant rs821616 [ dbSNP | Ensembl ]. | VAR_022438 | |||||
Experimental info | |||||||||
| Mutagenesis | 815 | 1 | L → P: Impairs interaction with NDEL1; when associated with P-822. Ref.12 | ||||||
| Mutagenesis | 822 | 1 | L → P: Impairs interaction with NDEL1; when associated with P-815. Ref.12 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Disruption of two novel genes by a schizophrenia-linked translocation." Millar J.K., Wilson-Annan J.C., Anderson S., Christie S., Taylor M.S., Semple C.A.M., Devon R.S., St Clair D.M., Muir W.J., Blackwood D.H.R., Porteous D.J. Hum. Mol. Genet. 9:1415-1423(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANTS GLN-264 AND CYS-704. |
| [2] | "Evolutionary constraints on the Disrupted in Schizophrenia locus." Taylor M.S., Devon R.S., Millar J.K., Porteous D.J. Genomics 81:67-77(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), VARIANT GLN-264. Tissue: Fetal heart. |
| [3] | "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O. DNA Res. 4:345-349(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-264. Tissue: Brain. |
| [4] | "DISC1 splice variants are upregulated in schizophrenia and associated with risk polymorphisms." Nakata K., Lipska B.K., Hyde T.M., Ye T., Newburn E.N., Morita Y., Vakkalanka R., Barenboim M., Sei Y., Weinberger D.R., Kleinman J.E. Proc. Natl. Acad. Sci. U.S.A. 106:15873-15878(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 6; 7 AND 8), ALTERNATIVE SPLICING. Tissue: Brain. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Chromosome 1 loci in Finnish schizophrenia families." Ekelund J., Hovatta I., Parker A., Paunio T., Varilo T., Martin R., Suhonen J., Ellonen P., Chan G., Sinsheimer J.S., Sobel E., Juvonen H., Arajaervi R., Partonen T., Suvisaari J., Loennqvist J., Meyer J., Peltonen L. Hum. Mol. Genet. 10:1611-1617(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO SCZD9. |
| [7] | "DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation." Morris J.A., Kandpal G., Ma L., Austin C.P. Hum. Mol. Genet. 12:1591-1608(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ACTN2; ANKHD1; ATF4; ATF5; CEP63; EIF3S3; MAP1A; MICROTUBULES; NDEL1; RANBP9; SPTBN4; SYNE1 AND TRAF3IP1, SUBCELLULAR LOCATION. |
| [8] | "Haplotype transmission analysis provides evidence of association for DISC1 to schizophrenia and suggests sex-dependent effects." Hennah W., Varilo T., Kestilae M., Paunio T., Arajaervi R., Haukka J., Parker A., Martin R., Levitzky S., Partonen T., Meyer J., Loennqvist J., Peltonen L., Ekelund J. Hum. Mol. Genet. 12:3151-3159(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO SCZD9. |
| [9] | "Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth." Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 100:289-294(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NDEL1, SUBCELLULAR LOCATION. |
| [10] | Erratum Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 101:13969-13969(2004) |
| [11] | "Disrupted in schizophrenia 1 (DISC1): association with schizophrenia, schizoaffective disorder, and bipolar disorder." Hodgkinson C.A., Goldman D., Jaeger J., Persaud S., Kane J.M., Lipsky R.H., Malhotra A.K. Am. J. Hum. Genet. 75:862-872(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO SCZD, VARIANTS VAL-5 AND PHE-607. |
| [12] | "Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders." Brandon N.J., Handford E.J., Schurov I., Rain J.-C., Pelling M., Duran-Jimeniz B., Camargo L.M., Oliver K.R., Beher D., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 25:42-55(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TUBULIN ALPHA; NDEL1 AND PAFAH1B1, SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-815 AND LEU-822. |
| [13] | "Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site." Brandon N.J., Schurov I., Camargo L.M., Handford E.J., Duran-Jimeniz B., Hunt P., Millar J.K., Porteous D.J., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 28:613-624(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [14] | "Variation in DISC1 affects hippocampal structure and function and increases risk for schizophrenia." Callicott J.H., Straub R.E., Pezawas L., Egan M.F., Mattay V.S., Hariri A.R., Verchinski B.A., Meyer-Lindenberg A., Balkissoon R., Kolachana B., Goldberg T.E., Weinberger D.R. Proc. Natl. Acad. Sci. U.S.A. 102:8627-8632(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO SCZD9, VARIANT CYS-704. |
| [15] | "Expression of DISC1 binding partners is reduced in schizophrenia and associated with DISC1 SNPs." Lipska B.K., Peters T., Hyde T.M., Halim N., Horowitz C., Mitkus S., Weickert C.S., Matsumoto M., Sawa A., Straub R.E., Vakkalanka R., Herman M.M., Weinberger D.R., Kleinman J.E. Hum. Mol. Genet. 15:1245-1258(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [16] | "DISC1-NDEL1/NUDEL protein interaction, an essential component for neurite outgrowth, is modulated by genetic variations of DISC1." Kamiya A., Tomoda T., Chang J., Takaki M., Zhan C., Morita M., Cascio M.B., Elashvili S., Koizumi H., Takanezawa Y., Dickerson F., Yolken R., Arai H., Sawa A. Hum. Mol. Genet. 15:3313-3323(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NDEL1. |
| [17] | "DISC1-kendrin interaction is involved in centrosomal microtubule network formation." Shimizu S., Matsuzaki S., Hattori T., Kumamoto N., Miyoshi K., Katayama T., Tohyama M. Biochem. Biophys. Res. Commun. 377:1051-1056(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PCNT, SUBCELLULAR LOCATION. |
| [18] | "Disc1 regulates granule cell migration in the developing hippocampus." Meyer K.D., Morris J.A. Hum. Mol. Genet. 18:3286-3297(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [19] | "Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling." Mao Y., Ge X., Frank C.L., Madison J.M., Koehler A.N., Doud M.K., Tassa C., Berry E.M., Soda T., Singh K.K., Biechele T., Petryshen T.L., Moon R.T., Haggarty S.J., Tsai L.H. Cell 136:1017-1031(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [20] | "CHCM1/CHCHD6, a novel mitochondrial protein linked to regulation of mitofilin and mitochondrial cristae morphology." An J., Shi J., He Q., Lui K., Liu Y., Huang Y., Sheikh M.S. J. Biol. Chem. 287:7411-7426(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CHCHD6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF222983 Genomic DNA. Translation: AAF73874.1. AF222987 Genomic DNA. Translation: AAF73877.1. AF222980 mRNA. Translation: AAF73889.1. AJ506178 mRNA. Translation: CAD44628.1. AJ506177 mRNA. Translation: CAD44631.1. AB007926 mRNA. Translation: BAA32302.1. Different initiation. FJ804178 mRNA. Translation: ACR40044.1. FJ804184 mRNA. Translation: ACR40050.1. FJ804186 mRNA. Translation: ACR40052.1. FJ804190 mRNA. Translation: ACR40056.1. FJ804196 mRNA. Translation: ACR40062.1. FJ804205 mRNA. Translation: ACR40071.1. AL626763 AL450284 Genomic DNA. Translation: CAH70955.1. Sequence problems.AL626763 AL450284 Genomic DNA. Translation: CAH70956.1.AL626763, AL359543 Genomic DNA. Translation: CAH70957.1. AL450284 AL626763 Genomic DNA. Translation: CAI15677.1. Sequence problems.AL450284 AL626763 Genomic DNA. Translation: CAI15679.1.AL359543 AL626763 Genomic DNA. Translation: CAI17204.1. Sequence problems.AL359543 AL626763 Genomic DNA. Translation: CAI17206.1.AL359543, AL626763 Genomic DNA. Translation: CAI17207.1. AL136171 AL626763 Genomic DNA. Translation: CAI21886.1. Sequence problems.AL136171 AL626763 Genomic DNA. Translation: CAI21888.1.AL161743 AL626763 Genomic DNA. Translation: CAI22543.1. Sequence problems.AL445200 AL626763 Genomic DNA. Translation: CAI23013.1. Sequence problems.AL751364 Genomic DNA. No translation available. |
| IPI | IPI00032896. IPI00217534. IPI00554636. IPI00935747. IPI00944621. IPI00944658. IPI01014360. |
| PIR | T00071. |
| RefSeq | NP_001012975.1. NM_001012957.1. NP_001012976.1. NM_001012958.1. NP_001012977.1. NM_001012959.1. NP_001158011.1. NM_001164539.1. NP_001158013.1. NM_001164541.1. NP_001158017.1. NM_001164545.1. NP_001158018.1. NM_001164546.1. NP_001158019.1. NM_001164547.1. NP_061132.2. NM_018662.2. |
| UniGene | Hs.13318. |
3D structure databases | |
| ProteinModelPortal | Q9NRI5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-33828N. |
| IntAct | Q9NRI5. 100 interactions. |
PTM databases | |
| PhosphoSite | Q9NRI5. |
Polymorphism databases | |
| DMDM | 160332362. |
Proteomic databases | |
| PaxDb | Q9NRI5. |
| PRIDE | Q9NRI5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317586; ENSP00000320784; ENSG00000162946. ENST00000366633; ENSP00000355593; ENSG00000162946. ENST00000366636; ENSP00000355596; ENSG00000162946. ENST00000439617; ENSP00000403888; ENSG00000162946. ENST00000535983; ENSP00000443996; ENSG00000162946. ENST00000537876; ENSP00000440909; ENSG00000162946. ENST00000539444; ENSP00000440953; ENSG00000162946. |
| GeneID | 27185. |
| KEGG | hsa:27185. |
| UCSC | uc001hux.1. human. uc001huy.3. human. uc001huz.3. human. uc001hva.3. human. |
Organism-specific databases | |
| CTD | 27185. |
| GeneCards | GC01P231762. |
| HGNC | HGNC:2888. DISC1. |
| HPA | CAB013016. |
| MIM | 181500. phenotype. 604906. phenotype. 605210. gene. |
| neXtProt | NX_Q9NRI5. |
| Orphanet | 3140. Schizophrenia. |
| PharmGKB | PA27342. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG76097. |
| HOGENOM | HOG000056668. |
| HOVERGEN | HBG051360. |
| KO | K16534. |
| OrthoDB | EOG4DNF3X. |
Gene expression databases | |
| ArrayExpress | Q9NRI5. |
| Bgee | Q9NRI5. |
| Genevestigator | Q9NRI5. |
| GermOnline | ENSG00000162946. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026081. DISC1. [Graphical view] |
| PANTHER | PTHR14332. PTHR14332. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 27185. |
| NextBio | 50024. |
| SOURCE | Search... |
Entry information
| Entry name | DISC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRI5 Secondary accession number(s): A6NLH2 Q9NRI4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
