Q9NRG9 (AAAS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Aladin Alternative name(s): Adracalin | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 546 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in the normal development of the peripheral and central nervous system. |
| Tissue specificity | Widely expressed. Particularly abundant expression is found in cerebellum, corpus callosum, adrenal gland, pituitary gland, gastrointestinal structures and fetal lung. Ref.3 |
| Involvement in disease | Achalasia-addisonianism-alacrima syndrome (AAAS) [MIM:231550]: An autosomal recessive disorder characterized by adreno-corticotropic hormone (ACTH)-resistant adrenal failure, achalasia of the esophageal cardia and alacrima. The syndrome is associated with variable and progressive neurological impairment involving the central, peripheral, and autonomic nervous system. Other features such as palmoplantar hyperkeratosis, short stature, facial dysmorphy and osteoporosis may also be present. |
| Sequence similarities | Contains 4 WD repeats. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRG9-1) Also known as: AAAS-v1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRG9-2) Also known as: AAAS-v2; The sequence of this isoform differs from the canonical sequence as follows: 149-182: WSSCCLRVFAWHPHTNKFAVALLDDSVRVYNASS → C | ||||||
| Note: Ubiquitously expressed. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 546 | 546 | Aladin | PRO_0000050828 | |||||
Regions | |||||||||
| Repeat | 149 – 188 | 40 | WD 1 | ||||||
| Repeat | 191 – 230 | 40 | WD 2 | ||||||
| Repeat | 243 – 282 | 40 | WD 3 | ||||||
| Repeat | 285 – 324 | 40 | WD 4 | ||||||
| Motif | 544 – 546 | 3 | Microbody targeting signal Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 33 | 1 | Phosphoserine Ref.10 Ref.11 | ||||||
| Modified residue | 495 | 1 | Phosphoserine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 149 – 182 | 34 | WSSCC…YNASS → C in isoform 2. | VSP_043014 | |||||
| Natural variant | 15 | 1 | Q → K in AAAS. Ref.2 | VAR_012804 | |||||
| Natural variant | 108 | 1 | K → M. Corresponds to variant rs13330 [ dbSNP | Ensembl ]. | VAR_037060 | |||||
| Natural variant | 160 | 1 | H → R in AAAS. Ref.2 | VAR_012805 | |||||
| Natural variant | 263 | 1 | S → P in AAAS. Ref.2 | VAR_012806 | |||||
Experimental info | |||||||||
| Sequence conflict | 122 | 1 | S → P in BAA91394. Ref.5 | ||||||
| Sequence conflict | 135 | 1 | R → K in BAA91394. Ref.5 | ||||||
| Sequence conflict | 479 | 1 | I → V in BAA91394. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutant WD-repeat protein in triple-A syndrome." Tullio-Pelet A., Salomon R., Hadj-Rabia S., Mugnier C., de Laet M.-H., Chaouachi B., Bakiri F., Brottier P., Cattolico L., Penet C., Begeot M., Naville D., Nicolino M., Chaussain J.-L., Weissenbach J., Munnich A., Lyonnet S. Nat. Genet. 26:332-335(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). |
| [2] | "Triple A syndrome is caused by mutations in AAAS, a new WD-repeat protein gene." Handschug K., Sperling S., Yoon S.-J.K., Hennig S., Clark A.J.L., Huebner A. Hum. Mol. Genet. 10:283-290(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS AAAS LYS-15; ARG-160 AND PRO-263. |
| [3] | "Molecular cloning and characterization of AAAS-V2, a novel splice variant of human AAAS." Li X., Ji C., Gu J., Xu J., Jin Z., Sun L., Zou X., Lin Y., Sun R., Wang P., Gu S., Mao Y. Mol. Biol. Rep. 32:127-131(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. |
| [4] | "A novel gene expressed in human liver non-tumor tissues." Li Y., Wu T., Xu S., Ren S., Chen Z., Han Z. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adipose tissue. |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [9] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 210-546 (ISOFORM 1). Tissue: Uterus. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND SER-495, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ289857 mRNA. Translation: CAC19017.1. AJ289841 AJ289856 Genomic DNA. Translation: CAC19038.1.AJ297977 Genomic DNA. Translation: CAC17465.1. AY237818 mRNA. Translation: AAP69911.1. AF226048 mRNA. Translation: AAF86948.1. AK000833 mRNA. Translation: BAA91394.1. BT006912 mRNA. Translation: AAP35558.1. AC073611 Genomic DNA. No translation available. BC000659 mRNA. Translation: AAH00659.1. AL110160 mRNA. Translation: CAB53665.2. |
| IPI | IPI00024143. IPI00747361. |
| RefSeq | NP_001166937.1. NM_001173466.1. NP_056480.1. NM_015665.5. |
| UniGene | Hs.369144. |
3D structure databases | |
| ProteinModelPortal | Q9NRG9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NRG9. 1 interaction. |
| STRING | 9606.ENSP00000209873. |
PTM databases | |
| PhosphoSite | Q9NRG9. |
Polymorphism databases | |
| DMDM | 20137527. |
Proteomic databases | |
| PaxDb | Q9NRG9. |
| PRIDE | Q9NRG9. |
Protocols and materials databases | |
| DNASU | 8086. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000209873; ENSP00000209873; ENSG00000094914. ENST00000394384; ENSP00000377908; ENSG00000094914. |
| GeneID | 8086. |
| KEGG | hsa:8086. |
| UCSC | uc001scr.4. human. |
Organism-specific databases | |
| CTD | 8086. |
| GeneCards | GC12M053701. |
| HGNC | HGNC:13666. AAAS. |
| HPA | HPA040086. |
| MIM | 231550. phenotype. 605378. gene. |
| neXtProt | NX_Q9NRG9. |
| Orphanet | 869. Triple A syndrome. |
| PharmGKB | PA24361. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG314927. |
| HOGENOM | HOG000033741. |
| HOVERGEN | HBG026353. |
| InParanoid | Q9NRG9. |
| KO | K14320. |
| OMA | GEGKGCV. |
| OrthoDB | EOG4C2H96. |
| PhylomeDB | Q9NRG9. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. REACT_15518. Transmembrane transport of small molecules. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q9NRG9. |
| Bgee | Q9NRG9. |
| CleanEx | HS_AAAS. |
| Genevestigator | Q9NRG9. |
| GermOnline | ENSG00000094914. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. |
| InterPro | IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00400. WD40. 1 hit. [Graphical view] |
| SMART | SM00320. WD40. 4 hits. [Graphical view] |
| PROSITE | PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | AAAS. human. |
| GenomeRNAi | 8086. |
| NextBio | 30710. |
| SOURCE | Search... |
Entry information
| Entry name | AAAS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRG9 Secondary accession number(s): Q5JB47, Q9NWI6, Q9UG19 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
