Reviewed,
UniProtKB/Swiss-Prot Q9NRG1 (PRDC1_HUMAN)
Last modified
June 16, 2009.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phosphoribosyltransferase domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 225 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Sequence similarities | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | purine ribonucleoside salvage Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: InterPro |
| Molecular function | hypoxanthine phosphoribosyltransferase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRG1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRG1-2) The sequence of this isoform differs from the canonical sequence as follows: 185-225: YAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV → SHMRHQ | ||||||
| Isoform 3 (identifier: Q9NRG1-3) The sequence of this isoform differs from the canonical sequence as follows: 114-225: NDQSMGEMQI...NEHGKEKYRV → LRARLKRTTI...RFQLPRSEQN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 225 | 225 | Phosphoribosyltransferase domain-containing protein 1 | PRO_0000318176 | |||||
Natural variations | |||||||||
| Alternative sequence | 114 – 225 | 112 | NDQSM…EKYRV → LRARLKRTTICDRGGLAFSQ GYMSSCAPLQESPNTLWRGY LQVLIPCFHIRFQLPRSEQN in isoform 3. | VSP_031179 | |||||
| Alternative sequence | 185 – 225 | 41 | YAGFE…EKYRV → SHMRHQ in isoform 2. | VSP_031180 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | L → W in BAD93029. Ref.3 | ||||||
| Sequence conflict | 65 | 1 | G → R in BAD96394. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "A novel gene expressed in human liver cancer tissue." Li Y., Wu T., Xu S., Ren S., Chen Z., Han Z. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver cancer. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryo. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 2 AND 3). |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF226056 mRNA. Translation: AAF86956.1. AK021950 mRNA. Translation: BAB13944.1. AB209792 mRNA. Translation: BAD93029.1. Different initiation. AK222674 mRNA. Translation: BAD96394.1. AL157385, AL512598 Genomic DNA. Translation: CAH70349.1. AL157385, AL512598 Genomic DNA. Translation: CAH70350.1. AL157385, AL512598 Genomic DNA. Translation: CAH70351.1. AL512598, AL157385 Genomic DNA. Translation: CAH70785.1. AL512598, AL157385 Genomic DNA. Translation: CAH70786.1. AL512598, AL157385 Genomic DNA. Translation: CAH70787.1. CH471072 Genomic DNA. Translation: EAW86120.1. BC008662 mRNA. Translation: AAH08662.1. | |||||||||||||
| IPI | IPI00024644. IPI00477601. IPI00645291. | ||||||||||||
| RefSeq | NP_064585.1. | ||||||||||||
| UniGene | Hs.405619 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | Q9NRG1. Positions 9-225. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NRG1. 7 interactions. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NRG1. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000099256. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 56952. | ||||||||||||
| KEGG | hsa:56952. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC10M025177. | ||||||||||||
| HGNC | HGNC:23333. PRTFDC1. | ||||||||||||
| MIM | 610751. gene. | ||||||||||||
| PharmGKB | PA134888009. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q9NRG1. | ||||||||||||
| OMA | Q9NRG1. MSSCAPL. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NRG1. | ||||||||||||
| Bgee | Q9NRG1. | ||||||||||||
| CleanEx | HS_PRTFDC1. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005904. Hxn_phspho_trans. IPR002375. Pr/py_Pribosyl_transf_CS. IPR000836. PRibTrfase. [Graphical view] | ||||||||||||
| Pfam | PF00156. Pribosyltran. 1 hit. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR01203. HGPRTase. 1 hit. | ||||||||||||
| PROSITE | PS00103. PUR_PYR_PR_TRANSFER. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 62559. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PRDC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRG1 Secondary accession number(s): Q53HA7 Q5VV20 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


