Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NRG1

- PRDC1_HUMAN

UniProt

Q9NRG1 - PRDC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphoribosyltransferase domain-containing protein 1

Gene

PRTFDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi141 – 1411MagnesiumCurated
Metal bindingi142 – 1421MagnesiumCurated
Binding sitei173 – 1731GMP1 Publication
Metal bindingi201 – 2011MagnesiumCurated
Binding sitei201 – 2011GMP; via amide nitrogen and carbonyl oxygen1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi141 – 1499GMP1 Publication
Nucleotide bindingi194 – 1952GMP1 Publication

GO - Molecular functioni

  1. magnesium ion binding Source: UniProtKB
  2. nucleotide binding Source: UniProtKB-KW
  3. protein homodimerization activity Source: UniProtKB

GO - Biological processi

  1. nucleoside metabolic process Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphoribosyltransferase domain-containing protein 1
Gene namesi
Name:PRTFDC1
Synonyms:HHGP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:23333. PRTFDC1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: RefGenome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134888009.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed2 Publications
Chaini2 – 225224Phosphoribosyltransferase domain-containing protein 1PRO_0000318176Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine2 Publications

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9NRG1.
PaxDbiQ9NRG1.
PRIDEiQ9NRG1.

PTM databases

PhosphoSiteiQ9NRG1.

Expressioni

Gene expression databases

BgeeiQ9NRG1.
CleanExiHS_PRTFDC1.
GenevestigatoriQ9NRG1.

Organism-specific databases

HPAiHPA021458.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi121276. 15 interactions.
IntActiQ9NRG1. 7 interactions.
MINTiMINT-1447274.
STRINGi9606.ENSP00000318602.

Structurei

Secondary structure

1
225
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi11 – 133Combined sources
Helixi26 – 283Combined sources
Helixi33 – 353Combined sources
Beta strandi38 – 447Combined sources
Helixi46 – 6419Combined sources
Beta strandi69 – 757Combined sources
Turni76 – 783Combined sources
Helixi79 – 9517Combined sources
Beta strandi102 – 1098Combined sources
Beta strandi123 – 1275Combined sources
Helixi129 – 1324Combined sources
Beta strandi135 – 14713Combined sources
Helixi148 – 15811Combined sources
Beta strandi163 – 17311Combined sources
Beta strandi184 – 1907Combined sources
Beta strandi210 – 2156Combined sources
Helixi217 – 2226Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2JBHX-ray1.70A/B1-225[»]
ProteinModelPortaliQ9NRG1.
SMRiQ9NRG1. Positions 9-225.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NRG1.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0634.
GeneTreeiENSGT00390000017323.
HOGENOMiHOG000236521.
HOVERGENiHBG000242.
InParanoidiQ9NRG1.
OMAiECHAHEA.
OrthoDBiEOG7673CK.
PhylomeDBiQ9NRG1.
TreeFamiTF313367.

Family and domain databases

Gene3Di3.40.50.2020. 1 hit.
InterProiIPR005904. Hxn_phspho_trans.
IPR000836. PRibTrfase_dom.
IPR029057. PRTase-like.
[Graphical view]
PfamiPF00156. Pribosyltran. 1 hit.
[Graphical view]
SUPFAMiSSF53271. SSF53271. 1 hit.
TIGRFAMsiTIGR01203. HGPRTase. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NRG1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGSSEEAPD YGRGVVIMDD WPGYDLNLFT YPQHYYGDLE YVLIPHGIIV
60 70 80 90 100
DRIERLAKDI MKDIGYSDIM VLCVLKGGYK FCADLVEHLK NISRNSDRFV
110 120 130 140 150
SMKVDFIRLK SYRNDQSMGE MQIIGGDDLS TLAGKNVLIV EDVVGTGRTM
160 170 180 190 200
KALLSNIEKY KPNMIKVASL LVKRTSRSDG FRPDYAGFEI PNLFVVGYAL
210 220
DYNEYFRDLN HICVINEHGK EKYRV
Length:225
Mass (Da):25,674
Last modified:October 1, 2000 - v1
Checksum:iCD612C2783AC3071
GO
Isoform 2 (identifier: Q9NRG1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-225: YAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV → SHMRHQ

Show »
Length:190
Mass (Da):21,558
Checksum:i97D7F77097F49A5A
GO
Isoform 3 (identifier: Q9NRG1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     114-225: NDQSMGEMQI...NEHGKEKYRV → LRARLKRTTI...RFQLPRSEQN

Show »
Length:173
Mass (Da):19,983
Checksum:iC807E4679F19B334
GO

Sequence cautioni

The sequence BAD93029.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti39 – 391L → W in BAD93029. 1 PublicationCurated
Sequence conflicti65 – 651G → R in BAD96394. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei114 – 225112NDQSM…EKYRV → LRARLKRTTICDRGGLAFSQ GYMSSCAPLQESPNTLWRGY LQVLIPCFHIRFQLPRSEQN in isoform 3. CuratedVSP_031179Add
BLAST
Alternative sequencei185 – 22541YAGFE…EKYRV → SHMRHQ in isoform 2. 1 PublicationVSP_031180Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF226056 mRNA. Translation: AAF86956.1.
AK021950 mRNA. Translation: BAB13944.1.
AB209792 mRNA. Translation: BAD93029.1. Different initiation.
AK222674 mRNA. Translation: BAD96394.1.
AK294130 mRNA. Translation: BAH11679.1.
AL157385, AL512598 Genomic DNA. Translation: CAH70349.1.
AL157385, AL512598 Genomic DNA. Translation: CAH70350.1.
AL157385, AL512598 Genomic DNA. Translation: CAH70351.1.
AL512598, AL157385 Genomic DNA. Translation: CAH70785.1.
AL512598, AL157385 Genomic DNA. Translation: CAH70786.1.
AL512598, AL157385 Genomic DNA. Translation: CAH70787.1.
CH471072 Genomic DNA. Translation: EAW86120.1.
BC008662 mRNA. Translation: AAH08662.1.
CCDSiCCDS60506.1. [Q9NRG1-2]
CCDS7145.1. [Q9NRG1-1]
RefSeqiNP_001269715.1. NM_001282786.1. [Q9NRG1-2]
NP_064585.1. NM_020200.6. [Q9NRG1-1]
UniGeneiHs.405619.

Genome annotation databases

EnsembliENST00000320152; ENSP00000318602; ENSG00000099256. [Q9NRG1-1]
ENST00000376376; ENSP00000365556; ENSG00000099256. [Q9NRG1-3]
ENST00000376378; ENSP00000365558; ENSG00000099256. [Q9NRG1-2]
GeneIDi56952.
KEGGihsa:56952.
UCSCiuc001ise.1. human. [Q9NRG1-1]
uc010qdd.1. human. [Q9NRG1-2]

Polymorphism databases

DMDMi74752920.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF226056 mRNA. Translation: AAF86956.1 .
AK021950 mRNA. Translation: BAB13944.1 .
AB209792 mRNA. Translation: BAD93029.1 . Different initiation.
AK222674 mRNA. Translation: BAD96394.1 .
AK294130 mRNA. Translation: BAH11679.1 .
AL157385 , AL512598 Genomic DNA. Translation: CAH70349.1 .
AL157385 , AL512598 Genomic DNA. Translation: CAH70350.1 .
AL157385 , AL512598 Genomic DNA. Translation: CAH70351.1 .
AL512598 , AL157385 Genomic DNA. Translation: CAH70785.1 .
AL512598 , AL157385 Genomic DNA. Translation: CAH70786.1 .
AL512598 , AL157385 Genomic DNA. Translation: CAH70787.1 .
CH471072 Genomic DNA. Translation: EAW86120.1 .
BC008662 mRNA. Translation: AAH08662.1 .
CCDSi CCDS60506.1. [Q9NRG1-2 ]
CCDS7145.1. [Q9NRG1-1 ]
RefSeqi NP_001269715.1. NM_001282786.1. [Q9NRG1-2 ]
NP_064585.1. NM_020200.6. [Q9NRG1-1 ]
UniGenei Hs.405619.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2JBH X-ray 1.70 A/B 1-225 [» ]
ProteinModelPortali Q9NRG1.
SMRi Q9NRG1. Positions 9-225.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121276. 15 interactions.
IntActi Q9NRG1. 7 interactions.
MINTi MINT-1447274.
STRINGi 9606.ENSP00000318602.

PTM databases

PhosphoSitei Q9NRG1.

Polymorphism databases

DMDMi 74752920.

Proteomic databases

MaxQBi Q9NRG1.
PaxDbi Q9NRG1.
PRIDEi Q9NRG1.

Protocols and materials databases

DNASUi 56952.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000320152 ; ENSP00000318602 ; ENSG00000099256 . [Q9NRG1-1 ]
ENST00000376376 ; ENSP00000365556 ; ENSG00000099256 . [Q9NRG1-3 ]
ENST00000376378 ; ENSP00000365558 ; ENSG00000099256 . [Q9NRG1-2 ]
GeneIDi 56952.
KEGGi hsa:56952.
UCSCi uc001ise.1. human. [Q9NRG1-1 ]
uc010qdd.1. human. [Q9NRG1-2 ]

Organism-specific databases

CTDi 56952.
GeneCardsi GC10M025177.
HGNCi HGNC:23333. PRTFDC1.
HPAi HPA021458.
MIMi 610751. gene.
neXtProti NX_Q9NRG1.
PharmGKBi PA134888009.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0634.
GeneTreei ENSGT00390000017323.
HOGENOMi HOG000236521.
HOVERGENi HBG000242.
InParanoidi Q9NRG1.
OMAi ECHAHEA.
OrthoDBi EOG7673CK.
PhylomeDBi Q9NRG1.
TreeFami TF313367.

Miscellaneous databases

ChiTaRSi PRTFDC1. human.
EvolutionaryTracei Q9NRG1.
GenomeRNAii 56952.
NextBioi 62559.
PROi Q9NRG1.
SOURCEi Search...

Gene expression databases

Bgeei Q9NRG1.
CleanExi HS_PRTFDC1.
Genevestigatori Q9NRG1.

Family and domain databases

Gene3Di 3.40.50.2020. 1 hit.
InterProi IPR005904. Hxn_phspho_trans.
IPR000836. PRibTrfase_dom.
IPR029057. PRTase-like.
[Graphical view ]
Pfami PF00156. Pribosyltran. 1 hit.
[Graphical view ]
SUPFAMi SSF53271. SSF53271. 1 hit.
TIGRFAMsi TIGR01203. HGPRTase. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene expressed in human liver cancer tissue."
    Li Y., Wu T., Xu S., Ren S., Chen Z., Han Z.
    Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver cancer.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain cortex and Embryo.
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 2 AND 3).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  7. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  8. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Structural and functional studies of the human phosphoribosyltransferase domain containing protein 1."
    Welin M., Egeblad L., Johansson A., Stenmark P., Wang L., Flodin S., Nyman T., Tresaugues L., Kotenyova T., Johansson I., Eriksson S., Eklund H., Nordlund P.
    FEBS J. 277:4920-4930(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) IN COMPLEX WITH GMP; PHOSPHATE AND CALCIUM IONS, SUBUNIT, ABSENCE OF PHOSPHORIBOSYLTRANSFERASE ACTIVITY.

Entry informationi

Entry nameiPRDC1_HUMAN
AccessioniPrimary (citable) accession number: Q9NRG1
Secondary accession number(s): B7Z1Z3
, Q53HA7, Q59EL9, Q5VV18, Q5VV20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 1, 2000
Last modified: November 26, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Lacks the conserved active site Asp and has no significant phosphoribosyltransferase activity.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3