Q9NRG1 (PRDC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphoribosyltransferase domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 225 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage. |
| Subunit structure | Homodimer. Ref.7 |
| Sequence similarities | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
| Caution | Lacks the conserved active site Asp and has no significant phosphoribosyltransferase activity. |
| Sequence caution | The sequence BAD93029.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding Nucleotide-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nucleoside metabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cytosol Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Molecular_function | magnesium ion binding Traceable author statement Ref.7. Source: UniProtKB nucleotide bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRG1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRG1-2) The sequence of this isoform differs from the canonical sequence as follows: 185-225: YAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV → SHMRHQ | ||||||
| Isoform 3 (identifier: Q9NRG1-3) The sequence of this isoform differs from the canonical sequence as follows: 114-225: NDQSMGEMQI...NEHGKEKYRV → LRARLKRTTI...RFQLPRSEQN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 225 | 225 | Phosphoribosyltransferase domain-containing protein 1 | PRO_0000318176 | ||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 141 – 149 | 9 | GMP | |||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 194 – 195 | 2 | GMP | |||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||
| Metal binding | 141 | 1 | Magnesium Probable | |||||||||||||||||||||||||||||||||||||
| Metal binding | 142 | 1 | Magnesium Probable | |||||||||||||||||||||||||||||||||||||
| Metal binding | 201 | 1 | Magnesium Probable | |||||||||||||||||||||||||||||||||||||
| Binding site | 173 | 1 | GMP | |||||||||||||||||||||||||||||||||||||
| Binding site | 201 | 1 | GMP; via amide nitrogen and carbonyl oxygen | |||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 114 – 225 | 112 | NDQSM…EKYRV → LRARLKRTTICDRGGLAFSQ GYMSSCAPLQESPNTLWRGY LQVLIPCFHIRFQLPRSEQN in isoform 3. | VSP_031179 | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 185 – 225 | 41 | YAGFE…EKYRV → SHMRHQ in isoform 2. | VSP_031180 | ||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 39 | 1 | L → W in BAD93029. Ref.3 | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 65 | 1 | G → R in BAD96394. Ref.3 | |||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||
| Helix | 11 – 13 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 26 – 28 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 33 – 35 | 3 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 44 | 7 | ||||||||||||||||||||||||||||||||||||||
| Helix | 46 – 64 | 19 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 75 | 7 | ||||||||||||||||||||||||||||||||||||||
| Turn | 76 – 78 | 3 | ||||||||||||||||||||||||||||||||||||||
| Helix | 79 – 95 | 17 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 109 | 8 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 123 – 127 | 5 | ||||||||||||||||||||||||||||||||||||||
| Helix | 129 – 132 | 4 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 147 | 13 | ||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 158 | 11 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 163 – 173 | 11 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 190 | 7 | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 210 – 215 | 6 | ||||||||||||||||||||||||||||||||||||||
| Helix | 217 – 222 | 6 | ||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel gene expressed in human liver cancer tissue." Li Y., Wu T., Xu S., Ren S., Chen Z., Han Z. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver cancer. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain cortex and Embryo. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 2 AND 3). |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [7] | "Structural and functional studies of the human phosphoribosyltransferase domain containing protein 1." Welin M., Egeblad L., Johansson A., Stenmark P., Wang L., Flodin S., Nyman T., Tresaugues L., Kotenyova T., Johansson I., Eriksson S., Eklund H., Nordlund P. FEBS J. 277:4920-4930(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) IN COMPLEX WITH GMP; PHOSPHATE AND CALCIUM IONS, SUBUNIT, ABSENCE OF PHOSPHORIBOSYLTRANSFERASE ACTIVITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF226056 mRNA. Translation: AAF86956.1. AK021950 mRNA. Translation: BAB13944.1. AB209792 mRNA. Translation: BAD93029.1. Different initiation. AK222674 mRNA. Translation: BAD96394.1. AK294130 mRNA. Translation: BAH11679.1. AL157385, AL512598 Genomic DNA. Translation: CAH70349.1. AL157385, AL512598 Genomic DNA. Translation: CAH70350.1. AL157385, AL512598 Genomic DNA. Translation: CAH70351.1. AL512598, AL157385 Genomic DNA. Translation: CAH70785.1. AL512598, AL157385 Genomic DNA. Translation: CAH70786.1. AL512598, AL157385 Genomic DNA. Translation: CAH70787.1. CH471072 Genomic DNA. Translation: EAW86120.1. BC008662 mRNA. Translation: AAH08662.1. | ||||||||||||
| IPI | IPI00024644. IPI00477601. IPI00645291. | ||||||||||||
| RefSeq | NP_064585.1. NM_020200.5. | ||||||||||||
| UniGene | Hs.405619. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NRG1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NRG1. 7 interactions. | ||||||||||||
| MINT | MINT-1447274. | ||||||||||||
| STRING | 9606.ENSP00000318602. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NRG1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74752920. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9NRG1. | ||||||||||||
| PRIDE | Q9NRG1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 56952. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000320152; ENSP00000318602; ENSG00000099256. ENST00000376376; ENSP00000365556; ENSG00000099256. ENST00000376378; ENSP00000365558; ENSG00000099256. | ||||||||||||
| GeneID | 56952. | ||||||||||||
| KEGG | hsa:56952. | ||||||||||||
| UCSC | uc001ise.1. human. uc010qdd.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 56952. | ||||||||||||
| GeneCards | GC10M025177. | ||||||||||||
| HGNC | HGNC:23333. PRTFDC1. | ||||||||||||
| HPA | HPA021458. | ||||||||||||
| MIM | 610751. gene. | ||||||||||||
| neXtProt | NX_Q9NRG1. | ||||||||||||
| PharmGKB | PA134888009. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0634. | ||||||||||||
| HOGENOM | HOG000236521. | ||||||||||||
| HOVERGEN | HBG000242. | ||||||||||||
| OMA | SIKIVTL. | ||||||||||||
| OrthoDB | EOG4H72CM. | ||||||||||||
| PhylomeDB | Q9NRG1. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q9NRG1. | ||||||||||||
| CleanEx | HS_PRTFDC1. | ||||||||||||
| Genevestigator | Q9NRG1. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005904. Hxn_phspho_trans. IPR000836. PRibTrfase_dom. [Graphical view] | ||||||||||||
| Pfam | PF00156. Pribosyltran. 1 hit. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR01203. HGPRTase. 1 hit. | ||||||||||||
| PROSITE | PS00103. PUR_PYR_PR_TRANSFER. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | PRTFDC1. human. | ||||||||||||
| EvolutionaryTrace | Q9NRG1. | ||||||||||||
| GenomeRNAi | 56952. | ||||||||||||
| NextBio | 62559. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PRDC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRG1 Secondary accession number(s): B7Z1Z3 Q5VV20 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
