Q9NRC8 (SIR7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NAD-dependent protein deacetylase sirtuin-7 EC=3.5.1.- Alternative name(s): Regulatory protein SIR2 homolog 7 SIR2-like protein 7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | NAD-dependent protein deacetylase that specifically mediates deacetylation of histone H3 at 'Lys-18' (H3K18Ac). In contrast to other histone deacetylases, displays selectivity for a single histone mark, H3K18Ac, directly linked to control of gene expression. H3K18Ac is mainly present around the transcription start site of genes and has been linked to activation of nuclear hormone receptors. SIRT7 thereby acts as a transcription repressor. Moreover, H3K18 hypoacetylation has been reported as a marker of malignancy in various cancers and seems to maintain the transformed phenotype of cancer cells. These data suggest that SIRT7 may play a key role in oncogenic transformation by suppresses expression of tumor suppressor genes by locus-specific deacetylation of H3K18Ac at promoter regions. Also required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis: promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex. May also deacetylate p53/TP53 and promotes cell survival, however such data need additional confirmation. Ref.10 Ref.11 Ref.13 |
| Catalytic activity | NAD+ + an acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a protein. Ref.13 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Interacts with UBTF and the RNA polymerase I complex. Interacts with components of the B-WICH complex, such as MYBBP1A, SMARCA5/SNF2H and BAZ1B/WSTF. Interacts with ELK4, leading to stabilization at target promoters for H3K18Ac deacetylation. Interacts with histone H2A and/or histone H2B. Ref.10 Ref.11 Ref.12 Ref.13 |
| Subcellular location | Cytoplasm. Nucleus › nucleolus. Note: Located close to the nuclear membrane when in the cytoplasm. Associated with chromatin. Associated with rDNA promoter and transcribed region. Associated with nucleolar organizer regions during mitosis. Ref.6 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 |
| Post-translational modification | Phosphorylated during mitosis Probable. Ref.11 |
| Miscellaneous | Overexpressed in human thyroid carcinoma cell lines and tissues, but not in adenomas. |
| Sequence similarities | Belongs to the sirtuin family. Class IV subfamily. Contains 1 deacetylase sirtuin-type domain. |
| Caution | Was originally (Ref.6) termed SIR-T8/SIRT8. This was later retracted (Ref.7). See also Ref.8. |
| Sequence caution | The sequence CAB70848.2 differs from that shown. Reason: |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NRC8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NRC8-2) The sequence of this isoform differs from the canonical sequence as follows: 162-183: QHVVSQNCDGLHLRSGLPRTAI → RALGGWYTCQGPGRAPWCPVGN 184-400: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NRC8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MAAGGLSRSERKAAERVRRLREEQQRERLR → MPGPRRRSPSACP 336-400: WQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT → VL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | NAD-dependent protein deacetylase sirtuin-7 | PRO_0000110271 | |||||
Regions | |||||||||
| Domain | 90 – 331 | 242 | Deacetylase sirtuin-type | ||||||
| Nucleotide binding | 107 – 126 | 20 | NAD By similarity | ||||||
| Nucleotide binding | 167 – 170 | 4 | NAD By similarity | ||||||
| Nucleotide binding | 268 – 270 | 3 | NAD By similarity | ||||||
| Nucleotide binding | 297 – 299 | 3 | NAD By similarity | ||||||
| Compositional bias | 8 – 74 | 67 | Arg-rich | ||||||
Sites | |||||||||
| Active site | 187 | 1 | Proton acceptor | ||||||
| Metal binding | 195 | 1 | Zinc By similarity | ||||||
| Metal binding | 198 | 1 | Zinc By similarity | ||||||
| Metal binding | 225 | 1 | Zinc By similarity | ||||||
| Metal binding | 228 | 1 | Zinc By similarity | ||||||
| Binding site | 315 | 1 | NAD; via amide nitrogen By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | MAAGG…RERLR → MPGPRRRSPSACP in isoform 3. | VSP_044396 | |||||
| Alternative sequence | 162 – 183 | 22 | QHVVS…PRTAI → RALGGWYTCQGPGRAPWCPV GN in isoform 2. | VSP_008736 | |||||
| Alternative sequence | 184 – 400 | 217 | Missing in isoform 2. | VSP_008737 | |||||
| Alternative sequence | 336 – 400 | 65 | WQDPI…RKKVT → VL in isoform 3. | VSP_044397 | |||||
Experimental info | |||||||||
| Mutagenesis | 111 | 1 | S → A: Abolishes activation of pre-rRNA synthesis. Ref.10 Ref.12 | ||||||
| Mutagenesis | 187 | 1 | H → Y: Abolishes deacetylase activity and activation of pre-rRNA synthesis. Ref.10 Ref.13 | ||||||
| Sequence conflict | 71 | 1 | L → Q in BAG52860. Ref.2 | ||||||
| Sequence conflict | 384 | 1 | G → S in BAF82954. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Phylogenetic classification of prokaryotic and eukaryotic Sir-2 like proteins." Frye R.A. Biochem. Biophys. Res. Commun. 273:793-798(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Spleen. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Cerebellum, Colon and Placenta. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver and Lymph. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 128-400 (ISOFORM 1). Tissue: Testis. |
| [6] | "Isolation of a SIR-like gene, SIR-T8, that is overexpressed in thyroid carcinoma cell lines and tissues." de Nigris F., Cerutti J., Morelli C., Califano D., Chiariotti L., Viglietto G., Santelli G., Fusco A. Br. J. Cancer 86:917-923(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [7] | Erratum De Nigris F., Cerutti J., Morelli C., Califano D., Chiariotti L., Viglietto G., Santelli G., Fusco A. Br. J. Cancer 87:1479-1479(2002) [PubMed] [Europe PMC] [Abstract] |
| [8] | "'SIRT8' expressed in thyroid cancer is actually SIRT7." Frye R.A. Br. J. Cancer 87:1479-1479(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SHOWS THAT SIR-T8 IS SIRT7. |
| [9] | "Evolutionarily conserved and nonconserved cellular localizations and functions of human SIRT proteins." Michishita E., Park J.Y., Burneskis J.M., Barrett J.C., Horikawa I. Mol. Biol. Cell 16:4623-4635(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [10] | "Mammalian Sir2 homolog SIRT7 is an activator of RNA polymerase I transcription." Ford E., Voit R., Liszt G., Magin C., Grummt I., Guarente L. Genes Dev. 20:1075-1080(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN A RNA POLYMERASE I COMPLEX, INTERACTION WITH HISTONE H2A AND/OR HISTONE H2B, MUTAGENESIS OF SER-111 AND HIS-187, SUBCELLULAR LOCATION. |
| [11] | "Involvement of SIRT7 in resumption of rDNA transcription at the exit from mitosis." Grob A., Roussel P., Wright J.E., McStay B., Hernandez-Verdun D., Sirri V. J. Cell Sci. 122:489-498(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH UBTF, PHOSPHORYLATION, SUBCELLULAR LOCATION. |
| [12] | "Functional proteomics establishes the interaction of SIRT7 with chromatin remodeling complexes and expands its role in regulation of RNA polymerase I transcription." Tsai Y.C., Greco T.M., Boonmee A., Miteva Y., Cristea I.M. Mol. Cell. Proteomics 11:M111.015156.01-M111.015156.17(2012) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH MYBBP1A; SMARCA5 AND BAZ1B, MUTAGENESIS OF SER-111. |
| [13] | "SIRT7 links H3K18 deacetylation to maintenance of oncogenic transformation." Barber M.F., Michishita-Kioi E., Xi Y., Tasselli L., Kioi M., Moqtaderi Z., Tennen R.I., Paredes S., Young N.L., Chen K., Struhl K., Garcia B.A., Gozani O., Li W., Chua K.F. Nature 487:114-118(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH ELK4, MUTAGENESIS OF HIS-187. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF233395 mRNA. Translation: AAF43431.1. AK002027 mRNA. Translation: BAA92044.1. AK094326 mRNA. Translation: BAG52860.1. AK290265 mRNA. Translation: BAF82954.1. AC145207 Genomic DNA. No translation available. BC017305 mRNA. Translation: AAH17305.1. BC101791 mRNA. Translation: AAI01792.1. BC101793 mRNA. Translation: AAI01794.1. AL137626 mRNA. Translation: CAB70848.2. Sequence problems. |
| IPI | IPI00334648. IPI00383601. |
| PIR | T46324. |
| RefSeq | NP_057622.1. NM_016538.2. |
| UniGene | Hs.514636. |
3D structure databases | |
| ProteinModelPortal | Q9NRC8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-59906N. |
| IntAct | Q9NRC8. 2 interactions. |
| MINT | MINT-1424083. |
| STRING | 9606.ENSP00000329466. |
Polymorphism databases | |
| DMDM | 38258650. |
Proteomic databases | |
| PaxDb | Q9NRC8. |
| PRIDE | Q9NRC8. |
Protocols and materials databases | |
| DNASU | 51547. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000328666; ENSP00000329466; ENSG00000187531. |
| GeneID | 51547. |
| KEGG | hsa:51547. |
| UCSC | uc002kcj.2. human. |
Organism-specific databases | |
| CTD | 51547. |
| GeneCards | GC17M079869. |
| HGNC | HGNC:14935. SIRT7. |
| HPA | CAB037261. |
| MIM | 606212. gene. |
| neXtProt | NX_Q9NRC8. |
| PharmGKB | PA37940. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0846. |
| HOGENOM | HOG000231240. |
| HOVERGEN | HBG060028. |
| InParanoid | Q9NRC8. |
| KO | K11417. |
| OMA | WFGRGCA. |
| OrthoDB | EOG4FN4HW. |
| PhylomeDB | Q9NRC8. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hdac_classi_pathway. Signaling events mediated by HDAC Class I. hdac_classiii_pathway. Signaling events mediated by HDAC Class III. |
Gene expression databases | |
| ArrayExpress | Q9NRC8. |
| Bgee | Q9NRC8. |
| CleanEx | HS_SIRT7. |
| Genevestigator | Q9NRC8. |
| GermOnline | ENSG00000187531. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003000. Sirtuin. IPR026590. Ssirtuin_cat_dom. [Graphical view] |
| PANTHER | PTHR11085. PTHR11085. 1 hit. |
| Pfam | PF02146. SIR2. 1 hit. [Graphical view] |
| PROSITE | PS50305. SIRTUIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SIRT7. human. |
| GenomeRNAi | 51547. |
| NextBio | 35463912. |
| SOURCE | Search... |
Entry information
| Entry name | SIR7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NRC8 Secondary accession number(s): A8K2K0 Q9NUS6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
