Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor of tumorigenicity 7 protein

Gene

ST7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May act as a tumor suppressor.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor of tumorigenicity 7 protein
Alternative name(s):
Protein FAM4A1
Protein HELG
Gene namesi
Name:ST7
Synonyms:FAM4A1, HELG, RAY1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:11351. ST7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei512 – 532HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7982.
OpenTargetsiENSG00000004866.
PharmGKBiPA36173.

Polymorphism and mutation databases

BioMutaiST7.
DMDMi74734319.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003392021 – 585Suppressor of tumorigenicity 7 proteinAdd BLAST585

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...)Sequence analysis1
Modified residuei386PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9NRC1.
PeptideAtlasiQ9NRC1.
PRIDEiQ9NRC1.
TopDownProteomicsiQ9NRC1-1. [Q9NRC1-1]

PTM databases

iPTMnetiQ9NRC1.
PhosphoSitePlusiQ9NRC1.

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in heart, liver and pancreas.2 Publications

Gene expression databases

BgeeiENSG00000004866.
CleanExiHS_ST7.
ExpressionAtlasiQ9NRC1. baseline and differential.
GenevisibleiQ9NRC1. HS.

Organism-specific databases

HPAiHPA038325.
HPA038326.

Interactioni

Protein-protein interaction databases

BioGridi113695. 25 interactors.
IntActiQ9NRC1. 2 interactors.
STRINGi9606.ENSP00000265437.

Structurei

3D structure databases

ProteinModelPortaliQ9NRC1.
SMRiQ9NRC1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ST7 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3807. Eukaryota.
ENOG410XQ2Z. LUCA.
GeneTreeiENSGT00390000000873.
HOVERGENiHBG054916.
InParanoidiQ9NRC1.
OMAiVFAKAMI.
OrthoDBiEOG091G05WJ.
PhylomeDBiQ9NRC1.
TreeFamiTF314162.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR007311. ST7.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PANTHERiPTHR12745. PTHR12745. 2 hits.
PfamiPF04184. ST7. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NRC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEAATGFLE QLKSCIVWSW TYLWTVWFFI VLFLVYILRV PLKINDNLST
60 70 80 90 100
VSMFLNTLTP KFYVALTGTS SLISGLILIF EWWYFRKYGT SFIEQVSVSH
110 120 130 140 150
LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR
160 170 180 190 200
YTWVTGREPL TYYDMNLSAQ DHQTFFTCDS DHLRPADAIM QKAWRERNPQ
210 220 230 240 250
ARISAAHEAL EINEIRSRVE VPLIASSTIW EIKLLPKCAT AYILLAEEEA
260 270 280 290 300
TTIAEAEKLF KQALKAGDGC YRRSQQLQHH GSQYEAQHRR DTNVLVYIKR
310 320 330 340 350
RLAMCARRLG RTREAVKMMR DLMKEFPLLS MFNIHENLLE ALLELQAYAD
360 370 380 390 400
VQAVLAKYDD ISLPKSATIC YTAALLKARA VSDKFSPEAA SRRGLSTAEM
410 420 430 440 450
NAVEAIHRAV EFNPHVPKYL LEMKSLILPP EHILKRGDSE AIAYAFFHLA
460 470 480 490 500
HWKRVEGALN LLHCTWEGTF RMIPYPLEKG HLFYPYPICT ETADRELLPS
510 520 530 540 550
FHEVSVYPKK ELPFFILFTA GLCSFTAMLA LLTHQFPELM GVFAKAMIDI
560 570 580
FCSAEFRDWN CKSIFMRVED ELEIPPAPQS QHFQN
Length:585
Mass (Da):67,166
Last modified:October 1, 2000 - v1
Checksum:i7BA8974E564B307F
GO
Isoform 2 (identifier: Q9NRC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:554
Mass (Da):63,480
Checksum:i50DB3810D668D33D
GO
Isoform 3 (identifier: Q9NRC1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-122: Missing.
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:547
Mass (Da):62,819
Checksum:iB5F12BD1BE99BC56
GO
Isoform 4 (identifier: Q9NRC1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-50: WFFIVLFLVYILRVPLKINDNLST → MFGTESS
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:534
Mass (Da):60,928
Checksum:i96CEB7C19A6CAD81
GO
Isoform 5 (identifier: Q9NRC1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-50: WFFIVLFLVYILRVPLKINDNLST → MFGTESS
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:511
Mass (Da):58,297
Checksum:i8517998EB2148278
GO
Isoform 6 (identifier: Q9NRC1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     51-51: V → M
     215-237: Missing.
     464-469: CTWEGT → S
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:499
Mass (Da):56,999
Checksum:i3C86C8A734825025
GO
Isoform 7 (identifier: Q9NRC1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.
     419-422: YLLE → ARWK
     423-585: Missing.

Show »
Length:399
Mass (Da):45,665
Checksum:iE1B51714BFAE56FD
GO

Sequence cautioni

The sequence CAB86869 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW83520 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043932186A → T.1 PublicationCorresponds to variant rs201219065dbSNPEnsembl.1
Natural variantiVAR_043933361I → V.1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0341081 – 50Missing in isoform 6. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0341091 – 26Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_03411027 – 50WFFIV…DNLST → MFGTESS in isoform 4 and isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_03411151V → M in isoform 6. 1 Publication1
Alternative sequenceiVSP_034112116 – 122Missing in isoform 3. 1 Publication7
Alternative sequenceiVSP_034113215 – 237Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 7 PublicationsAdd BLAST23
Alternative sequenceiVSP_034114419 – 422YLLE → ARWK in isoform 7. 1 Publication4
Alternative sequenceiVSP_034115423 – 585Missing in isoform 7. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_034116464 – 469CTWEGT → S in isoform 6. 1 Publication6
Alternative sequenceiVSP_034117547 – 585MIDIF…QHFQN → FLSTLFAPLNFVMEKVESIL PSSLWHQLTRI in isoform 2, isoform 3, isoform 4, isoform 5 and isoform 6. 6 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234882 mRNA. Translation: AAF85945.1.
AF234883 mRNA. Translation: AAF85946.1.
AY009152 mRNA. Translation: AAG37720.1.
AY009153 mRNA. Translation: AAG37721.1.
AK093212 mRNA. Translation: BAC04097.1.
CH236947 Genomic DNA. Translation: EAL24356.1.
CH236947 Genomic DNA. Translation: EAL24357.1.
AC002542 Genomic DNA. Translation: AAS07414.1.
AC002542 Genomic DNA. Translation: AAS07415.1.
CH471070 Genomic DNA. Translation: EAW83520.1. Sequence problems.
BC030954 mRNA. Translation: AAH30954.1.
BC075855 mRNA. Translation: AAH75855.1.
AF415174 mRNA. Translation: AAL85662.1.
CR936656 mRNA. Translation: CAI56794.1.
AJ277291 mRNA. Translation: CAB86869.1. Different initiation.
CCDSiCCDS5769.1. [Q9NRC1-2]
CCDS5770.1. [Q9NRC1-1]
PIRiT50625.
RefSeqiNP_060882.2. NM_018412.3. [Q9NRC1-2]
NP_068708.1. NM_021908.2. [Q9NRC1-1]
UniGeneiHs.368131.

Genome annotation databases

EnsembliENST00000265437; ENSP00000265437; ENSG00000004866. [Q9NRC1-1]
ENST00000393443; ENSP00000377089; ENSG00000004866. [Q9NRC1-6]
ENST00000393451; ENSP00000377097; ENSG00000004866. [Q9NRC1-2]
GeneIDi7982.
KEGGihsa:7982.
UCSCiuc003vio.4. human. [Q9NRC1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234882 mRNA. Translation: AAF85945.1.
AF234883 mRNA. Translation: AAF85946.1.
AY009152 mRNA. Translation: AAG37720.1.
AY009153 mRNA. Translation: AAG37721.1.
AK093212 mRNA. Translation: BAC04097.1.
CH236947 Genomic DNA. Translation: EAL24356.1.
CH236947 Genomic DNA. Translation: EAL24357.1.
AC002542 Genomic DNA. Translation: AAS07414.1.
AC002542 Genomic DNA. Translation: AAS07415.1.
CH471070 Genomic DNA. Translation: EAW83520.1. Sequence problems.
BC030954 mRNA. Translation: AAH30954.1.
BC075855 mRNA. Translation: AAH75855.1.
AF415174 mRNA. Translation: AAL85662.1.
CR936656 mRNA. Translation: CAI56794.1.
AJ277291 mRNA. Translation: CAB86869.1. Different initiation.
CCDSiCCDS5769.1. [Q9NRC1-2]
CCDS5770.1. [Q9NRC1-1]
PIRiT50625.
RefSeqiNP_060882.2. NM_018412.3. [Q9NRC1-2]
NP_068708.1. NM_021908.2. [Q9NRC1-1]
UniGeneiHs.368131.

3D structure databases

ProteinModelPortaliQ9NRC1.
SMRiQ9NRC1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113695. 25 interactors.
IntActiQ9NRC1. 2 interactors.
STRINGi9606.ENSP00000265437.

PTM databases

iPTMnetiQ9NRC1.
PhosphoSitePlusiQ9NRC1.

Polymorphism and mutation databases

BioMutaiST7.
DMDMi74734319.

Proteomic databases

PaxDbiQ9NRC1.
PeptideAtlasiQ9NRC1.
PRIDEiQ9NRC1.
TopDownProteomicsiQ9NRC1-1. [Q9NRC1-1]

Protocols and materials databases

DNASUi7982.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265437; ENSP00000265437; ENSG00000004866. [Q9NRC1-1]
ENST00000393443; ENSP00000377089; ENSG00000004866. [Q9NRC1-6]
ENST00000393451; ENSP00000377097; ENSG00000004866. [Q9NRC1-2]
GeneIDi7982.
KEGGihsa:7982.
UCSCiuc003vio.4. human. [Q9NRC1-1]

Organism-specific databases

CTDi7982.
DisGeNETi7982.
GeneCardsiST7.
H-InvDBHIX0033793.
HGNCiHGNC:11351. ST7.
HPAiHPA038325.
HPA038326.
MIMi600833. gene.
neXtProtiNX_Q9NRC1.
OpenTargetsiENSG00000004866.
PharmGKBiPA36173.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3807. Eukaryota.
ENOG410XQ2Z. LUCA.
GeneTreeiENSGT00390000000873.
HOVERGENiHBG054916.
InParanoidiQ9NRC1.
OMAiVFAKAMI.
OrthoDBiEOG091G05WJ.
PhylomeDBiQ9NRC1.
TreeFamiTF314162.

Miscellaneous databases

ChiTaRSiST7. human.
GeneWikiiST7.
GenomeRNAii7982.
PROiQ9NRC1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000004866.
CleanExiHS_ST7.
ExpressionAtlasiQ9NRC1. baseline and differential.
GenevisibleiQ9NRC1. HS.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR007311. ST7.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PANTHERiPTHR12745. PTHR12745. 2 hits.
PfamiPF04184. ST7. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiST7_HUMAN
AccessioniPrimary (citable) accession number: Q9NRC1
Secondary accession number(s): A4D0V2
, Q5CZ72, Q7LE31, Q7LE32, Q8NA32, Q8NEJ8, Q8TDI9, Q9BWX3, Q9BWX4, Q9NRC2, Q9NXZ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.