Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sphingosine kinase 2

Gene

SPHK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-dihydrosphingosine, D-erythro-sphingosine and L-threo-dihydrosphingosine. Binds phosphoinositides.1 Publication

Catalytic activityi

ATP + sphinganine = ADP + sphinganine 1-phosphate.1 Publication
ATP + sphingosine = ADP + sphingosine 1-phosphate.1 Publication

Cofactori

Mg2+By similarity

Enzyme regulationi

Inhibited by sulfatide.1 Publication

Kineticsi

  1. KM=3.4 µM for sphingosine1 Publication

    pH dependencei

    Optimum pH is 7.5.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei247 – 2471Proton donor/acceptorBy similarity
    Binding sitei252 – 2521ATPPROSITE-ProRule annotation
    Binding sitei344 – 3441SubstrateBy similarity
    Binding sitei351 – 3511ATPPROSITE-ProRule annotation
    Binding sitei357 – 3571ATPPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi188 – 1903ATPPROSITE-ProRule annotation
    Nucleotide bindingi220 – 2245ATPPROSITE-ProRule annotation
    Nucleotide bindingi277 – 2793ATPPROSITE-ProRule annotation
    Nucleotide bindingi622 – 6243ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    • ATP binding Source: UniProtKB-KW
    • D-erythro-sphingosine kinase activity Source: Ensembl
    • Ras GTPase binding Source: UniProtKB
    • sphinganine kinase activity Source: UniProtKB
    • sphingosine-1-phosphate receptor activity Source: UniProtKB

    GO - Biological processi

    • blood vessel development Source: Ensembl
    • brain development Source: Ensembl
    • cell proliferation Source: UniProtKB
    • lipid phosphorylation Source: GOC
    • negative regulation of apoptotic process Source: UniProtKB
    • positive regulation of cell proliferation Source: Ensembl
    • small molecule metabolic process Source: Reactome
    • sphinganine-1-phosphate biosynthetic process Source: UniProtKB
    • sphingolipid biosynthetic process Source: Reactome
    • sphingolipid metabolic process Source: Reactome
    • sphingosine-1-phosphate signaling pathway Source: GOC
    • sphingosine biosynthetic process Source: UniProtKB
    Complete GO annotation...

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.1.91. 2681.
    ReactomeiREACT_115810. Sphingolipid de novo biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sphingosine kinase 2 (EC:2.7.1.91)
    Short name:
    SK 2
    Short name:
    SPK 2
    Gene namesi
    Name:SPHK2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640 Componenti: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:18859. SPHK2.

    Subcellular locationi

    GO - Cellular componenti

    • cytosol Source: UniProtKB
    • lysosomal membrane Source: UniProtKB
    • membrane Source: UniProtKB
    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm, Lysosome, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38719.

    Polymorphism and mutation databases

    BioMutaiSPHK2.
    DMDMi22001996.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 654654Sphingosine kinase 2PRO_0000181358Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei477 – 4771Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9NRA0.
    PaxDbiQ9NRA0.
    PRIDEiQ9NRA0.

    PTM databases

    PhosphoSiteiQ9NRA0.

    Expressioni

    Gene expression databases

    BgeeiQ9NRA0.
    ExpressionAtlasiQ9NRA0. baseline and differential.
    GenevisibleiQ9NRA0. HS.

    Interactioni

    Protein-protein interaction databases

    BioGridi121208. 2 interactions.
    IntActiQ9NRA0. 5 interactions.
    STRINGi9606.ENSP00000245222.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NRA0.
    SMRiQ9NRA0. Positions 176-406, 514-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini178 – 325148DAGKcPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 175175Required for binding to sulfatide and phosphoinositides and for membrane localizationAdd
    BLAST
    Regioni245 – 2484Substrate bindingBy similarity

    Sequence similaritiesi

    Contains 1 DAGKc domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG1597.
    GeneTreeiENSGT00690000101761.
    HOGENOMiHOG000111460.
    HOVERGENiHBG054796.
    InParanoidiQ9NRA0.
    KOiK04718.
    OrthoDBiEOG7PCJGK.
    PhylomeDBiQ9NRA0.
    TreeFamiTF354296.

    Family and domain databases

    InterProiIPR001206. Diacylglycerol_kinase_cat_dom.
    IPR016064. NAD/diacylglycerol_kinase.
    [Graphical view]
    PfamiPF00781. DAGK_cat. 1 hit.
    [Graphical view]
    SMARTiSM00046. DAGKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF111331. SSF111331. 2 hits.
    PROSITEiPS50146. DAGK. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q9NRA0-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MNGHLEAEEQ QDQRPDQELT GSWGHGPRST LVRAKAMAPP PPPLAASTPL
    60 70 80 90 100
    LHGEFGSYPA RGPRFALTLT SQALHIQRLR PKPEARPRGG LVPLAEVSGC
    110 120 130 140 150
    CTLRSRSPSD SAAYFCIYTY PRGRRGARRR ATRTFRADGA ATYEENRAEA
    160 170 180 190 200
    QRWATALTCL LRGLPLPGDG EITPDLLPRP PRLLLLVNPF GGRGLAWQWC
    210 220 230 240 250
    KNHVLPMISE AGLSFNLIQT ERQNHARELV QGLSLSEWDG IVTVSGDGLL
    260 270 280 290 300
    HEVLNGLLDR PDWEEAVKMP VGILPCGSGN ALAGAVNQHG GFEPALGLDL
    310 320 330 340 350
    LLNCSLLLCR GGGHPLDLLS VTLASGSRCF SFLSVAWGFV SDVDIQSERF
    360 370 380 390 400
    RALGSARFTL GTVLGLATLH TYRGRLSYLP ATVEPASPTP AHSLPRAKSE
    410 420 430 440 450
    LTLTPDPAPP MAHSPLHRSV SDLPLPLPQP ALASPGSPEP LPILSLNGGG
    460 470 480 490 500
    PELAGDWGGA GDAPLSPDPL LSSPPGSPKA ALHSPVSEGA PVIPPSSGLP
    510 520 530 540 550
    LPTPDARVGA STCGPPDHLL PPLGTPLPPD WVTLEGDFVL MLAISPSHLG
    560 570 580 590 600
    ADLVAAPHAR FDDGLVHLCW VRSGISRAAL LRLFLAMERG SHFSLGCPQL
    610 620 630 640 650
    GYAAARAFRL EPLTPRGVLT VDGEQVEYGP LQAQMHPGIG TLLTGPPGCP

    GREP
    Length:654
    Mass (Da):69,217
    Last modified:July 26, 2002 - v2
    Checksum:iF73FFCEC930DA50F
    GO
    Isoform 2 (identifier: Q9NRA0-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.

    Show »
    Length:618
    Mass (Da):65,205
    Checksum:i1A5B06BCB6F93F1F
    GO
    Isoform 3 (identifier: Q9NRA0-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.
         292-390: FEPALGLDLL...ATVEPASPTP → PREDSDSSTS...NVFICKKKKK

    Show »
    Length:618
    Mass (Da):65,170
    Checksum:iD934F61C0A69EDAE
    GO
    Isoform 4 (identifier: Q9NRA0-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         13-71: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:595
    Mass (Da):62,986
    Checksum:iC24AC949EEEA059B
    GO
    Isoform 5 (identifier: Q9NRA0-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MNGHLEAEEQQD → MIGCLHARVS...NSHPFSPPFP
         640-654: GTLLTGPPGCPGREP → ARGRTQTPALPAAPALYGRQPGAAHGLQPVCQGAALFFHNSWLWGSQDLFRIVLTEAVGG

    Show »
    Length:761
    Mass (Da):80,205
    Checksum:iA52BF3441102A3D3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti49 – 491P → S in CAB66636 (PubMed:11230166).Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti652 – 6521R → Q.
    Corresponds to variant rs11881285 [ dbSNP | Ensembl ].
    VAR_060112

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636Missing in isoform 2 and isoform 3. 4 PublicationsVSP_006217Add
    BLAST
    Alternative sequencei1 – 1212MNGHL…EEQQD → MIGCLHARVSGPLWDAGLCP ASSRSAHTCLSLSVSDAPVS PATAPHCLLLSTAPAPPCPC HGVLNSHPFSPPFP in isoform 5. 1 PublicationVSP_047721Add
    BLAST
    Alternative sequencei13 – 7159Missing in isoform 4. 1 PublicationVSP_046910Add
    BLAST
    Alternative sequencei292 – 39099FEPAL…ASPTP → PREDSDSSTSSSACPLWTTA RSCPRAAASMPGSCPLLPQQ LALGFSRFIQDRVNGGGGRI GSLTCRGHTQRTLPAPAREG GGSLFLKNINVFICKKKKK in isoform 3. 1 PublicationVSP_006218Add
    BLAST
    Alternative sequencei640 – 65415GTLLT…PGREP → ARGRTQTPALPAAPALYGRQ PGAAHGLQPVCQGAALFFHN SWLWGSQDLFRIVLTEAVGG in isoform 5. 1 PublicationVSP_047722Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF245447 mRNA. Translation: AAF74124.1.
    EF107108 mRNA. Translation: ABK81123.1.
    AL136701 mRNA. Translation: CAB66636.1.
    AK000599 mRNA. Translation: BAA91280.1.
    AK300541 mRNA. Translation: BAG62249.1.
    AC022154 Genomic DNA. No translation available.
    BC006161 mRNA. Translation: AAH06161.1.
    BC010671 mRNA. Translation: AAH10671.1.
    CCDSiCCDS12727.1. [Q9NRA0-1]
    CCDS59404.1. [Q9NRA0-4]
    CCDS59405.1. [Q9NRA0-2]
    RefSeqiNP_001191087.1. NM_001204158.2. [Q9NRA0-4]
    NP_001191088.1. NM_001204159.2. [Q9NRA0-1]
    NP_001191089.1. NM_001204160.2. [Q9NRA0-2]
    NP_064511.2. NM_020126.4. [Q9NRA0-1]
    XP_006723354.1. XM_006723291.1. [Q9NRA0-1]
    XP_006723355.1. XM_006723292.1. [Q9NRA0-2]
    UniGeneiHs.528006.

    Genome annotation databases

    EnsembliENST00000245222; ENSP00000245222; ENSG00000063176. [Q9NRA0-1]
    ENST00000598088; ENSP00000469158; ENSG00000063176. [Q9NRA0-1]
    ENST00000599748; ENSP00000471205; ENSG00000063176. [Q9NRA0-2]
    ENST00000600537; ENSP00000470092; ENSG00000063176. [Q9NRA0-4]
    GeneIDi56848.
    KEGGihsa:56848.
    UCSCiuc002pjr.3. human. [Q9NRA0-1]
    uc002pju.3. human. [Q9NRA0-3]
    uc010xzt.2. human.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF245447 mRNA. Translation: AAF74124.1.
    EF107108 mRNA. Translation: ABK81123.1.
    AL136701 mRNA. Translation: CAB66636.1.
    AK000599 mRNA. Translation: BAA91280.1.
    AK300541 mRNA. Translation: BAG62249.1.
    AC022154 Genomic DNA. No translation available.
    BC006161 mRNA. Translation: AAH06161.1.
    BC010671 mRNA. Translation: AAH10671.1.
    CCDSiCCDS12727.1. [Q9NRA0-1]
    CCDS59404.1. [Q9NRA0-4]
    CCDS59405.1. [Q9NRA0-2]
    RefSeqiNP_001191087.1. NM_001204158.2. [Q9NRA0-4]
    NP_001191088.1. NM_001204159.2. [Q9NRA0-1]
    NP_001191089.1. NM_001204160.2. [Q9NRA0-2]
    NP_064511.2. NM_020126.4. [Q9NRA0-1]
    XP_006723354.1. XM_006723291.1. [Q9NRA0-1]
    XP_006723355.1. XM_006723292.1. [Q9NRA0-2]
    UniGeneiHs.528006.

    3D structure databases

    ProteinModelPortaliQ9NRA0.
    SMRiQ9NRA0. Positions 176-406, 514-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi121208. 2 interactions.
    IntActiQ9NRA0. 5 interactions.
    STRINGi9606.ENSP00000245222.

    Chemistry

    BindingDBiQ9NRA0.
    ChEMBLiCHEMBL3023.
    GuidetoPHARMACOLOGYi2205.

    PTM databases

    PhosphoSiteiQ9NRA0.

    Polymorphism and mutation databases

    BioMutaiSPHK2.
    DMDMi22001996.

    Proteomic databases

    MaxQBiQ9NRA0.
    PaxDbiQ9NRA0.
    PRIDEiQ9NRA0.

    Protocols and materials databases

    DNASUi56848.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000245222; ENSP00000245222; ENSG00000063176. [Q9NRA0-1]
    ENST00000598088; ENSP00000469158; ENSG00000063176. [Q9NRA0-1]
    ENST00000599748; ENSP00000471205; ENSG00000063176. [Q9NRA0-2]
    ENST00000600537; ENSP00000470092; ENSG00000063176. [Q9NRA0-4]
    GeneIDi56848.
    KEGGihsa:56848.
    UCSCiuc002pjr.3. human. [Q9NRA0-1]
    uc002pju.3. human. [Q9NRA0-3]
    uc010xzt.2. human.

    Organism-specific databases

    CTDi56848.
    GeneCardsiGC19P049122.
    HGNCiHGNC:18859. SPHK2.
    MIMi607092. gene.
    neXtProtiNX_Q9NRA0.
    PharmGKBiPA38719.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiCOG1597.
    GeneTreeiENSGT00690000101761.
    HOGENOMiHOG000111460.
    HOVERGENiHBG054796.
    InParanoidiQ9NRA0.
    KOiK04718.
    OrthoDBiEOG7PCJGK.
    PhylomeDBiQ9NRA0.
    TreeFamiTF354296.

    Enzyme and pathway databases

    BRENDAi2.7.1.91. 2681.
    ReactomeiREACT_115810. Sphingolipid de novo biosynthesis.

    Miscellaneous databases

    ChiTaRSiSPHK2. human.
    GeneWikiiSPHK2.
    GenomeRNAii56848.
    NextBioi35460299.
    PROiQ9NRA0.
    SOURCEiSearch...

    Gene expression databases

    BgeeiQ9NRA0.
    ExpressionAtlasiQ9NRA0. baseline and differential.
    GenevisibleiQ9NRA0. HS.

    Family and domain databases

    InterProiIPR001206. Diacylglycerol_kinase_cat_dom.
    IPR016064. NAD/diacylglycerol_kinase.
    [Graphical view]
    PfamiPF00781. DAGK_cat. 1 hit.
    [Graphical view]
    SMARTiSM00046. DAGKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF111331. SSF111331. 2 hits.
    PROSITEiPS50146. DAGK. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Publicationsi

    « Hide 'large scale' publications
    1. "Molecular cloning and functional characterization of a novel mammalian sphingosine kinase type 2 isoform."
      Liu H., Sugiura M., Nava V.E., Edsall L.C., Kono K., Poulton S., Milstien S., Kohama T., Spiegel S.
      J. Biol. Chem. 275:19513-19520(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CATALYTIC ACTIVITY, SUBSTRATE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY.
    2. "Variant of human sphingosine kinase-2 (SPHK2)."
      Alemany R., Ruemenapp U., van Koppen C.J., Danneberg K., Meyer zu Heringdorf D., Jakobs K.H.
      Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-354 (ISOFORM 3).
      Tissue: Carcinoma and Prostate.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Eye and Lymph.
    7. Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Placenta.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "A lipid binding domain in sphingosine kinase 2."
      Don A.S., Rosen H.
      Biochem. Biophys. Res. Commun. 380:87-92(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, ENZYME REGULATION, REGION.
    10. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
      Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
      J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-477, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiSPHK2_HUMAN
    AccessioniPrimary (citable) accession number: Q9NRA0
    Secondary accession number(s): A0T4C8
    , B4DU87, Q9BRN1, Q9H0Q2, Q9NWU7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 24, 2001
    Last sequence update: July 26, 2002
    Last modified: June 24, 2015
    This is version 134 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.