Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NR81 (ARHG3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Rho guanine nucleotide exchange factor 3
Alternative name(s):
Exchange factor found in platelets and leukemic and neuronal tissues
Short name=XPLN
Gene names
Name:ARHGEF3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length526 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases. Ref.8

Subunit structure

Interacts with RHOA and RHOB.

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney. Ref.1 Ref.8

Sequence similarities

Contains 1 DH (DBL-homology) domain.

Contains 1 PH domain.

Sequence caution

The sequence AAH68513.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB14891.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAD92898.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NR81-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NR81-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9NR81-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9NR81-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-202: Missing.
     203-204: GW → MK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 526526Rho guanine nucleotide exchange factor 3
PRO_0000080911

Regions

Domain122 – 304183DH
Domain291 – 449159PH

Natural variations

Alternative sequence1 – 202202Missing in isoform 4.
VSP_027204
Alternative sequence1 – 3232MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2.
VSP_011612
Alternative sequence1 – 3232MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3.
VSP_027205
Alternative sequence203 – 2042GW → MK in isoform 4.
VSP_027206
Natural variant131K → R.
Corresponds to variant rs3732507 [ dbSNP | Ensembl ].
VAR_021935
Natural variant3351L → V. Ref.3 Ref.4 Ref.6 Ref.7
Corresponds to variant rs3772219 [ dbSNP | Ensembl ].
VAR_021936

Experimental info

Sequence conflict4101I → T in AAP97313. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 0FE8248AB52D1CBC

FASTA52659,783
        10         20         30         40         50         60 
MVAKDYPFYL TVKRANCSLE LPPASGPAKD AEEPSNKRVK PLSRVTSLAN LIPPVKATPL 

        70         80         90        100        110        120 
KRFSQTLQRS ISFRSESRPD ILAPRPWSRN AAPSSTKRRD SKLWSETFDV CVNQMLTSKE 

       130        140        150        160        170        180 
IKRQEAIFEL SQGEEDLIED LKLAKKAYHD PMLKLSIMTE QELNQIFGTL DSLIPLHEEL 

       190        200        210        220        230        240 
LSQLRDVRKP DGSTEHVGPI LVGWLPCLSS YDSYCSNQVA AKALLDHKKQ DHRVQDFLQR 

       250        260        270        280        290        300 
CLESPFSRKL DLWNFLDIPR SRLVKYPLLL REILRHTPND NPDQQHLEEA INIIQGIVAE 

       310        320        330        340        350        360 
INTKTGESEC RYYKERLLYL EEGQKDSLID SSRVLCCHGE LKNNRGVKLH VFLFQEVLVI 

       370        380        390        400        410        420 
TRAVTHNEQL CYQLYRQPIP VKDLLLEDLQ DGEVRLGGSL RGAFSNNERI KNFFRVSFKN 

       430        440        450        460        470        480 
GSQSQTHSLQ ANDTFNKQQW LNCIRQAKET VLCAAGQAGV LDSEGSFLNP TTGSRELQGE 

       490        500        510        520 
TKLEQMDQSD SESDCSMDTS EVSLDCERME QTDSSCGNSR HGESNV 

« Hide

Isoform 2 [UniParc].

Checksum: C01C434F0858A58C
Show »

FASTA55863,755
Isoform 3 [UniParc].

Checksum: 64940517719915C0
Show »

FASTA53260,813
Isoform 4 [UniParc].

Checksum: DF90022C9392296E
Show »

FASTA32436,981

References

« Hide 'large scale' references
[1]"Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22."
Thiesen S., Kuebart S., Ropers H.-H., Nothwang H.G.
Biochem. Biophys. Res. Commun. 273:364-369(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[3]Guo J.H., Yu L.
Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-335.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 71-526 (ISOFORMS 1/2/3), VARIANT VAL-335.
Tissue: Brain and Placenta.
[5]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-335.
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-335.
Tissue: Hippocampus and Uterus.
[8]"XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC."
Arthur W.T., Ellerbroek S.M., Der C.J., Burridge K., Wennerberg K.
J. Biol. Chem. 277:42964-42972(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF249744 mRNA. Translation: AAF79954.1.
AL136832 mRNA. Translation: CAB66766.1.
AF433662 mRNA. Translation: AAP97313.1.
AK024340 mRNA. Translation: BAB14891.1. Different initiation.
AK291412 mRNA. Translation: BAF84101.1.
AB209661 mRNA. Translation: BAD92898.1. Different initiation.
CH471055 Genomic DNA. Translation: EAW65326.1.
BC054345 mRNA. Translation: AAH54345.2.
BC068513 mRNA. Translation: AAH68513.1. Different initiation.
BC098122 mRNA. Translation: AAH98122.2.
BC098272 mRNA. Translation: AAH98272.2.
BC099715 mRNA. Translation: AAH99715.1.
BC104723 mRNA. Translation: AAI04724.2.
CCDSCCDS2878.1. [Q9NR81-1]
CCDS46854.1. [Q9NR81-2]
CCDS46855.1. [Q9NR81-3]
RefSeqNP_001122087.1. NM_001128615.1. [Q9NR81-2]
NP_001122088.1. NM_001128616.1. [Q9NR81-3]
NP_001276627.1. NM_001289698.1.
NP_062455.1. NM_019555.2. [Q9NR81-1]
XP_005265243.1. XM_005265186.2. [Q9NR81-2]
XP_005265244.1. XM_005265187.1. [Q9NR81-2]
UniGeneHs.476402.

3D structure databases

ProteinModelPortalQ9NR81.
SMRQ9NR81. Positions 114-449.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119115. 5 interactions.
MINTMINT-3034386.

PTM databases

PhosphoSiteQ9NR81.

Polymorphism databases

DMDM52782760.

Proteomic databases

MaxQBQ9NR81.
PaxDbQ9NR81.
PRIDEQ9NR81.

Protocols and materials databases

DNASU50650.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000296315; ENSP00000296315; ENSG00000163947. [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947. [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947. [Q9NR81-3]
GeneID50650.
KEGGhsa:50650.
UCSCuc003dif.2. human. [Q9NR81-3]
uc003dig.2. human. [Q9NR81-1]
uc003dih.2. human. [Q9NR81-2]
uc010hmy.1. human. [Q9NR81-4]

Organism-specific databases

CTD50650.
GeneCardsGC03M056736.
HGNCHGNC:683. ARHGEF3.
HPAHPA034715.
MIM612115. gene.
neXtProtNX_Q9NR81.
PharmGKBPA24973.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5422.
HOVERGENHBG050567.
OMATKLEQMD.
OrthoDBEOG7J446D.
PhylomeDBQ9NR81.
TreeFamTF328974.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressQ9NR81.
BgeeQ9NR81.
CleanExHS_ARHGEF3.
GenevestigatorQ9NR81.

Family and domain databases

Gene3D1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_like_dom.
IPR001849. Pleckstrin_homology.
IPR015721. RhoGEF-like.
[Graphical view]
PANTHERPTHR22825. PTHR22825. 1 hit.
PfamPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMSSF48065. SSF48065. 1 hit.
PROSITEPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSARHGEF3. human.
GeneWikiARHGEF3.
GenomeRNAi50650.
NextBio53200.
PROQ9NR81.
SOURCESearch...

Entry information

Entry nameARHG3_HUMAN
AccessionPrimary (citable) accession number: Q9NR81
Secondary accession number(s): A8K5U7 expand/collapse secondary AC list , Q4FZB6, Q4QQI5, Q4QQQ0, Q59F00, Q6NUN3, Q7Z4U2, Q7Z5T2, Q9H7T4
Entry history
Integrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM