Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 3

Gene

ARHGEF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-193648. NRAGE signals death through JNK.
R-HSA-194840. Rho GTPase cycle.
R-HSA-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 3
Alternative name(s):
Exchange factor found in platelets and leukemic and neuronal tissues
Short name:
XPLN
Gene namesi
Name:ARHGEF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000163947.11.
HGNCiHGNC:683. ARHGEF3.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi50650.
OpenTargetsiENSG00000163947.
PharmGKBiPA24973.

Polymorphism and mutation databases

BioMutaiARHGEF3.
DMDMi52782760.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809111 – 526Rho guanine nucleotide exchange factor 3Add BLAST526

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineCombined sources1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NR81.
PaxDbiQ9NR81.
PeptideAtlasiQ9NR81.
PRIDEiQ9NR81.

PTM databases

iPTMnetiQ9NR81.
PhosphoSitePlusiQ9NR81.

Expressioni

Tissue specificityi

Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney.2 Publications

Gene expression databases

BgeeiENSG00000163947.
CleanExiHS_ARHGEF3.
ExpressionAtlasiQ9NR81. baseline and differential.
GenevisibleiQ9NR81. HS.

Organism-specific databases

HPAiHPA034715.
HPA064945.

Interactioni

Subunit structurei

Interacts with RHOA and RHOB.

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119115. 9 interactors.
IntActiQ9NR81. 7 interactors.
MINTiMINT-3034386.
STRINGi9606.ENSP00000341071.

Structurei

3D structure databases

ProteinModelPortaliQ9NR81.
SMRiQ9NR81.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini122 – 304DHPROSITE-ProRule annotationAdd BLAST183
Domaini291 – 449PHPROSITE-ProRule annotationAdd BLAST159

Phylogenomic databases

eggNOGiKOG4305. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00760000119193.
HOVERGENiHBG050567.
InParanoidiQ9NR81.
KOiK20683.
OMAiGWLPCLS.
OrthoDBiEOG091G05S7.
PhylomeDBiQ9NR81.
TreeFamiTF328974.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiView protein in InterPro
IPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
PfamiView protein in Pfam
PF00621. RhoGEF. 1 hit.
SMARTiView protein in SMART
SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiView protein in PROSITE
PS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NR81-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAKDYPFYL TVKRANCSLE LPPASGPAKD AEEPSNKRVK PLSRVTSLAN
60 70 80 90 100
LIPPVKATPL KRFSQTLQRS ISFRSESRPD ILAPRPWSRN AAPSSTKRRD
110 120 130 140 150
SKLWSETFDV CVNQMLTSKE IKRQEAIFEL SQGEEDLIED LKLAKKAYHD
160 170 180 190 200
PMLKLSIMTE QELNQIFGTL DSLIPLHEEL LSQLRDVRKP DGSTEHVGPI
210 220 230 240 250
LVGWLPCLSS YDSYCSNQVA AKALLDHKKQ DHRVQDFLQR CLESPFSRKL
260 270 280 290 300
DLWNFLDIPR SRLVKYPLLL REILRHTPND NPDQQHLEEA INIIQGIVAE
310 320 330 340 350
INTKTGESEC RYYKERLLYL EEGQKDSLID SSRVLCCHGE LKNNRGVKLH
360 370 380 390 400
VFLFQEVLVI TRAVTHNEQL CYQLYRQPIP VKDLLLEDLQ DGEVRLGGSL
410 420 430 440 450
RGAFSNNERI KNFFRVSFKN GSQSQTHSLQ ANDTFNKQQW LNCIRQAKET
460 470 480 490 500
VLCAAGQAGV LDSEGSFLNP TTGSRELQGE TKLEQMDQSD SESDCSMDTS
510 520
EVSLDCERME QTDSSCGNSR HGESNV
Length:526
Mass (Da):59,783
Last modified:October 1, 2000 - v1
Checksum:i0FE8248AB52D1CBC
GO
Isoform 2 (identifier: Q9NR81-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS

Note: No experimental confirmation available.
Show »
Length:558
Mass (Da):63,755
Checksum:iC01C434F0858A58C
GO
Isoform 3 (identifier: Q9NR81-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):60,813
Checksum:i64940517719915C0
GO
Isoform 4 (identifier: Q9NR81-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-202: Missing.
     203-204: GW → MK

Note: No experimental confirmation available.
Show »
Length:324
Mass (Da):36,981
Checksum:iDF90022C9392296E
GO

Sequence cautioni

The sequence AAH68513 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14891 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92898 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti410I → T in AAP97313 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02193513K → R. Corresponds to variant dbSNP:rs3732507Ensembl.1
Natural variantiVAR_021936335L → V4 PublicationsCorresponds to variant dbSNP:rs3772219Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0272041 – 202Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_0116121 – 32MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0272051 – 32MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027206203 – 204GW → MK in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF249744 mRNA. Translation: AAF79954.1.
AL136832 mRNA. Translation: CAB66766.1.
AF433662 mRNA. Translation: AAP97313.1.
AK024340 mRNA. Translation: BAB14891.1. Different initiation.
AK291412 mRNA. Translation: BAF84101.1.
AB209661 mRNA. Translation: BAD92898.1. Different initiation.
CH471055 Genomic DNA. Translation: EAW65326.1.
BC054345 mRNA. Translation: AAH54345.2.
BC068513 mRNA. Translation: AAH68513.1. Different initiation.
BC098122 mRNA. Translation: AAH98122.2.
BC098272 mRNA. Translation: AAH98272.2.
BC099715 mRNA. Translation: AAH99715.1.
BC104723 mRNA. Translation: AAI04724.2.
CCDSiCCDS2878.1. [Q9NR81-1]
CCDS46854.1. [Q9NR81-2]
CCDS46855.1. [Q9NR81-3]
RefSeqiNP_001122087.1. NM_001128615.1. [Q9NR81-2]
NP_001122088.1. NM_001128616.1. [Q9NR81-3]
NP_001276627.1. NM_001289698.1.
NP_062455.1. NM_019555.2. [Q9NR81-1]
XP_005265243.1. XM_005265186.4. [Q9NR81-2]
XP_005265244.1. XM_005265187.3. [Q9NR81-2]
UniGeneiHs.476402.

Genome annotation databases

EnsembliENST00000296315; ENSP00000296315; ENSG00000163947. [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947. [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947. [Q9NR81-3]
GeneIDi50650.
KEGGihsa:50650.
UCSCiuc003dif.3. human. [Q9NR81-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiARHG3_HUMAN
AccessioniPrimary (citable) accession number: Q9NR81
Secondary accession number(s): A8K5U7
, Q4FZB6, Q4QQI5, Q4QQQ0, Q59F00, Q6NUN3, Q7Z4U2, Q7Z5T2, Q9H7T4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: October 1, 2000
Last modified: September 27, 2017
This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot