Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NR81

- ARHG3_HUMAN

UniProt

Q9NR81 - ARHG3_HUMAN

Protein

Rho guanine nucleotide exchange factor 3

Gene

ARHGEF3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

    GO - Molecular functioni

    1. Rho guanyl-nucleotide exchange factor activity Source: ProtInc

    GO - Biological processi

    1. apoptotic signaling pathway Source: Reactome
    2. neurotrophin TRK receptor signaling pathway Source: Reactome
    3. positive regulation of apoptotic process Source: Reactome
    4. positive regulation of Rho GTPase activity Source: GOC
    5. regulation of small GTPase mediated signal transduction Source: Reactome
    6. Rho protein signal transduction Source: ProtInc
    7. small GTPase mediated signal transduction Source: Reactome

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho guanine nucleotide exchange factor 3
    Alternative name(s):
    Exchange factor found in platelets and leukemic and neuronal tissues
    Short name:
    XPLN
    Gene namesi
    Name:ARHGEF3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:683. ARHGEF3.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. intracellular Source: LIFEdb

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24973.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 526526Rho guanine nucleotide exchange factor 3PRO_0000080911Add
    BLAST

    Proteomic databases

    MaxQBiQ9NR81.
    PaxDbiQ9NR81.
    PRIDEiQ9NR81.

    PTM databases

    PhosphoSiteiQ9NR81.

    Expressioni

    Tissue specificityi

    Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney.2 Publications

    Gene expression databases

    ArrayExpressiQ9NR81.
    BgeeiQ9NR81.
    CleanExiHS_ARHGEF3.
    GenevestigatoriQ9NR81.

    Organism-specific databases

    HPAiHPA034715.

    Interactioni

    Subunit structurei

    Interacts with RHOA and RHOB.

    Protein-protein interaction databases

    BioGridi119115. 5 interactions.
    MINTiMINT-3034386.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NR81.
    SMRiQ9NR81. Positions 114-449.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini122 – 304183DHPROSITE-ProRule annotationAdd
    BLAST
    Domaini291 – 449159PHPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5422.
    HOVERGENiHBG050567.
    OMAiTKLEQMD.
    OrthoDBiEOG7J446D.
    PhylomeDBiQ9NR81.
    TreeFamiTF328974.

    Family and domain databases

    Gene3Di1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR000219. DH-domain.
    IPR001331. GDS_CDC24_CS.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR015721. RhoGEF-like.
    [Graphical view]
    PANTHERiPTHR22825. PTHR22825. 1 hit.
    PfamiPF00621. RhoGEF. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    [Graphical view]
    SUPFAMiSSF48065. SSF48065. 1 hit.
    PROSITEiPS00741. DH_1. 1 hit.
    PS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NR81-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVAKDYPFYL TVKRANCSLE LPPASGPAKD AEEPSNKRVK PLSRVTSLAN    50
    LIPPVKATPL KRFSQTLQRS ISFRSESRPD ILAPRPWSRN AAPSSTKRRD 100
    SKLWSETFDV CVNQMLTSKE IKRQEAIFEL SQGEEDLIED LKLAKKAYHD 150
    PMLKLSIMTE QELNQIFGTL DSLIPLHEEL LSQLRDVRKP DGSTEHVGPI 200
    LVGWLPCLSS YDSYCSNQVA AKALLDHKKQ DHRVQDFLQR CLESPFSRKL 250
    DLWNFLDIPR SRLVKYPLLL REILRHTPND NPDQQHLEEA INIIQGIVAE 300
    INTKTGESEC RYYKERLLYL EEGQKDSLID SSRVLCCHGE LKNNRGVKLH 350
    VFLFQEVLVI TRAVTHNEQL CYQLYRQPIP VKDLLLEDLQ DGEVRLGGSL 400
    RGAFSNNERI KNFFRVSFKN GSQSQTHSLQ ANDTFNKQQW LNCIRQAKET 450
    VLCAAGQAGV LDSEGSFLNP TTGSRELQGE TKLEQMDQSD SESDCSMDTS 500
    EVSLDCERME QTDSSCGNSR HGESNV 526
    Length:526
    Mass (Da):59,783
    Last modified:October 1, 2000 - v1
    Checksum:i0FE8248AB52D1CBC
    GO
    Isoform 2 (identifier: Q9NR81-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS

    Note: No experimental confirmation available.

    Show »
    Length:558
    Mass (Da):63,755
    Checksum:iC01C434F0858A58C
    GO
    Isoform 3 (identifier: Q9NR81-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR

    Note: No experimental confirmation available.

    Show »
    Length:532
    Mass (Da):60,813
    Checksum:i64940517719915C0
    GO
    Isoform 4 (identifier: Q9NR81-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-202: Missing.
         203-204: GW → MK

    Note: No experimental confirmation available.

    Show »
    Length:324
    Mass (Da):36,981
    Checksum:iDF90022C9392296E
    GO

    Sequence cautioni

    The sequence AAH68513.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB14891.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD92898.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti410 – 4101I → T in AAP97313. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti13 – 131K → R.
    Corresponds to variant rs3732507 [ dbSNP | Ensembl ].
    VAR_021935
    Natural varianti335 – 3351L → V.4 Publications
    Corresponds to variant rs3772219 [ dbSNP | Ensembl ].
    VAR_021936

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 202202Missing in isoform 4. 1 PublicationVSP_027204Add
    BLAST
    Alternative sequencei1 – 3232MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2. 1 PublicationVSP_011612Add
    BLAST
    Alternative sequencei1 – 3232MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3. 1 PublicationVSP_027205Add
    BLAST
    Alternative sequencei203 – 2042GW → MK in isoform 4. 1 PublicationVSP_027206

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF249744 mRNA. Translation: AAF79954.1.
    AL136832 mRNA. Translation: CAB66766.1.
    AF433662 mRNA. Translation: AAP97313.1.
    AK024340 mRNA. Translation: BAB14891.1. Different initiation.
    AK291412 mRNA. Translation: BAF84101.1.
    AB209661 mRNA. Translation: BAD92898.1. Different initiation.
    CH471055 Genomic DNA. Translation: EAW65326.1.
    BC054345 mRNA. Translation: AAH54345.2.
    BC068513 mRNA. Translation: AAH68513.1. Different initiation.
    BC098122 mRNA. Translation: AAH98122.2.
    BC098272 mRNA. Translation: AAH98272.2.
    BC099715 mRNA. Translation: AAH99715.1.
    BC104723 mRNA. Translation: AAI04724.2.
    CCDSiCCDS2878.1. [Q9NR81-1]
    CCDS46854.1. [Q9NR81-2]
    CCDS46855.1. [Q9NR81-3]
    RefSeqiNP_001122087.1. NM_001128615.1. [Q9NR81-2]
    NP_001122088.1. NM_001128616.1. [Q9NR81-3]
    NP_001276627.1. NM_001289698.1.
    NP_062455.1. NM_019555.2. [Q9NR81-1]
    XP_005265243.1. XM_005265186.2. [Q9NR81-2]
    XP_005265244.1. XM_005265187.1. [Q9NR81-2]
    UniGeneiHs.476402.

    Genome annotation databases

    EnsembliENST00000296315; ENSP00000296315; ENSG00000163947. [Q9NR81-1]
    ENST00000338458; ENSP00000341071; ENSG00000163947. [Q9NR81-2]
    ENST00000413728; ENSP00000410922; ENSG00000163947. [Q9NR81-3]
    GeneIDi50650.
    KEGGihsa:50650.
    UCSCiuc003dif.2. human. [Q9NR81-3]
    uc003dig.2. human. [Q9NR81-1]
    uc003dih.2. human. [Q9NR81-2]
    uc010hmy.1. human. [Q9NR81-4]

    Polymorphism databases

    DMDMi52782760.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF249744 mRNA. Translation: AAF79954.1 .
    AL136832 mRNA. Translation: CAB66766.1 .
    AF433662 mRNA. Translation: AAP97313.1 .
    AK024340 mRNA. Translation: BAB14891.1 . Different initiation.
    AK291412 mRNA. Translation: BAF84101.1 .
    AB209661 mRNA. Translation: BAD92898.1 . Different initiation.
    CH471055 Genomic DNA. Translation: EAW65326.1 .
    BC054345 mRNA. Translation: AAH54345.2 .
    BC068513 mRNA. Translation: AAH68513.1 . Different initiation.
    BC098122 mRNA. Translation: AAH98122.2 .
    BC098272 mRNA. Translation: AAH98272.2 .
    BC099715 mRNA. Translation: AAH99715.1 .
    BC104723 mRNA. Translation: AAI04724.2 .
    CCDSi CCDS2878.1. [Q9NR81-1 ]
    CCDS46854.1. [Q9NR81-2 ]
    CCDS46855.1. [Q9NR81-3 ]
    RefSeqi NP_001122087.1. NM_001128615.1. [Q9NR81-2 ]
    NP_001122088.1. NM_001128616.1. [Q9NR81-3 ]
    NP_001276627.1. NM_001289698.1.
    NP_062455.1. NM_019555.2. [Q9NR81-1 ]
    XP_005265243.1. XM_005265186.2. [Q9NR81-2 ]
    XP_005265244.1. XM_005265187.1. [Q9NR81-2 ]
    UniGenei Hs.476402.

    3D structure databases

    ProteinModelPortali Q9NR81.
    SMRi Q9NR81. Positions 114-449.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119115. 5 interactions.
    MINTi MINT-3034386.

    PTM databases

    PhosphoSitei Q9NR81.

    Polymorphism databases

    DMDMi 52782760.

    Proteomic databases

    MaxQBi Q9NR81.
    PaxDbi Q9NR81.
    PRIDEi Q9NR81.

    Protocols and materials databases

    DNASUi 50650.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000296315 ; ENSP00000296315 ; ENSG00000163947 . [Q9NR81-1 ]
    ENST00000338458 ; ENSP00000341071 ; ENSG00000163947 . [Q9NR81-2 ]
    ENST00000413728 ; ENSP00000410922 ; ENSG00000163947 . [Q9NR81-3 ]
    GeneIDi 50650.
    KEGGi hsa:50650.
    UCSCi uc003dif.2. human. [Q9NR81-3 ]
    uc003dig.2. human. [Q9NR81-1 ]
    uc003dih.2. human. [Q9NR81-2 ]
    uc010hmy.1. human. [Q9NR81-4 ]

    Organism-specific databases

    CTDi 50650.
    GeneCardsi GC03M056736.
    HGNCi HGNC:683. ARHGEF3.
    HPAi HPA034715.
    MIMi 612115. gene.
    neXtProti NX_Q9NR81.
    PharmGKBi PA24973.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5422.
    HOVERGENi HBG050567.
    OMAi TKLEQMD.
    OrthoDBi EOG7J446D.
    PhylomeDBi Q9NR81.
    TreeFami TF328974.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Miscellaneous databases

    ChiTaRSi ARHGEF3. human.
    GeneWikii ARHGEF3.
    GenomeRNAii 50650.
    NextBioi 53200.
    PROi Q9NR81.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NR81.
    Bgeei Q9NR81.
    CleanExi HS_ARHGEF3.
    Genevestigatori Q9NR81.

    Family and domain databases

    Gene3Di 1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR000219. DH-domain.
    IPR001331. GDS_CDC24_CS.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR015721. RhoGEF-like.
    [Graphical view ]
    PANTHERi PTHR22825. PTHR22825. 1 hit.
    Pfami PF00621. RhoGEF. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48065. SSF48065. 1 hit.
    PROSITEi PS00741. DH_1. 1 hit.
    PS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22."
      Thiesen S., Kuebart S., Ropers H.-H., Nothwang H.G.
      Biochem. Biophys. Res. Commun. 273:364-369(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    3. Guo J.H., Yu L.
      Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-335.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 71-526 (ISOFORMS 1/2/3), VARIANT VAL-335.
      Tissue: Brain and Placenta.
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-335.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT VAL-335.
      Tissue: Hippocampus and Uterus.
    8. "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC."
      Arthur W.T., Ellerbroek S.M., Der C.J., Burridge K., Wennerberg K.
      J. Biol. Chem. 277:42964-42972(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiARHG3_HUMAN
    AccessioniPrimary (citable) accession number: Q9NR81
    Secondary accession number(s): A8K5U7
    , Q4FZB6, Q4QQI5, Q4QQQ0, Q59F00, Q6NUN3, Q7Z4U2, Q7Z5T2, Q9H7T4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 27, 2004
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 116 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3