Q9NR28 (DBLOH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Diablo homolog, mitochondrial Alternative name(s): Direct IAP-binding protein with low pI Second mitochondria-derived activator of caspase Short name=Smac | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 239 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases. Isoform 3 attenuates the stability and apoptosis-inhibiting activity of XIAP/BIRC4 by promoting XIAP/BIRC4 ubiquitination and degradation through the ubiquitin-proteasome pathway. Isoform 3 also disrupts XIAP/BIRC4 interacting with processed caspase-9 and promotes caspase-3 activation. Isoform 1 is defective in the capacity to down-regulate the XIAP/BIRC4 abundance. Ref.1 Ref.3 Ref.7 |
| Subunit structure | Homodimer. Interacts with NGFRAP1/BEX3 By similarity. Interacts with BIRC2/c-IAP1, BIRC3/c-IAP2, XIAP/BIRC4, BIRC6/bruce and BIRC7/livin. Interacts with the monomeric and dimeric form of BIRC5/survivin. Ref.7 Ref.8 Ref.10 |
| Subcellular location | Mitochondrion. Note: Released into the cytosol when cells undergo apoptosis. Ref.3 |
| Tissue specificity | Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed. Ref.1 Ref.3 |
| Domain | The mature N-terminus mediates interaction with XIAP/BIRC4. |
| Post-translational modification | Ubiquitinated by BIRC7/livin. Ref.8 |
| Involvement in disease | Deafness, autosomal dominant, 64 (DFNA64) [MIM:614152]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BIRC2 | Q13490 | 4 | EBI-517508,EBI-514538 | |
| BIRC3 | Q13489 | 2 | EBI-517508,EBI-517709 | |
| BIRC7 | Q96CA5 | 6 | EBI-517508,EBI-517623 | |
| XIAP | P98170 | 7 | EBI-517508,EBI-517127 | |
| Xiap | Q60989 | 3 | EBI-517508,EBI-517478 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NR28-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NR28-2) Also known as: Diablo-S; The sequence of this isoform differs from the canonical sequence as follows: 1-60: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA → MKSDFYF | ||||||
| Isoform 3 (identifier: Q9NR28-3) Also known as: SMAC3; The sequence of this isoform differs from the canonical sequence as follows: 62-105: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 55 | 55 | Mitochondrion | |||||||||||||||
| Chain | 56 – 239 | 184 | Diablo homolog, mitochondrial | PRO_0000021072 | ||||||||||||||
Regions | ||||||||||||||||||
| Motif | 56 – 60 | 5 | IAP-binding | |||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 1 – 60 | 60 | MAALK…AVPIA → MKSDFYF in isoform 2. | VSP_004397 | ||||||||||||||
| Alternative sequence | 62 – 105 | 44 | Missing in isoform 3. | VSP_042785 | ||||||||||||||
| Natural variant | 126 | 1 | S → L in DFNA64; does not increase apoptotic activity compared to wild-type; enhances the degradation of mutant and wild-type protein via heterodimerization; cells expressing the mutant protein show increased susceptibility to calcium-induced loss of mitochondrial potential compared to wild-type, indicating increased sensitivity to mitochondrial stress and suggestive of mitochondrial dysfunction. Ref.13 | VAR_066487 | ||||||||||||||
Experimental info | ||||||||||||||||||
| Sequence conflict | 32 | 1 | K → E in BAB71568. Ref.4 | |||||||||||||||
| Sequence conflict | 44 | 1 | K → R in BAB14994. Ref.4 | |||||||||||||||
| Sequence conflict | 165 | 1 | E → K in BAB71568. Ref.4 | |||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Beta strand | 57 – 59 | 3 | ||||||||||||||||
| Helix | 69 – 119 | 51 | ||||||||||||||||
| Turn | 120 – 123 | 4 | ||||||||||||||||
| Helix | 127 – 173 | 47 | ||||||||||||||||
| Helix | 177 – 211 | 35 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Smac, a mitochondrial protein that promotes cytochrome c-dependent caspase activation by eliminating IAP inhibition." Du C., Fang M., Li Y., Li L., Wang X. Cell 102:33-42(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Molecular determinants of the caspase-promoting activity of Smac/DIABLO and its role in the death receptor pathway." Srinivasula S.M., Datta P., Fan X.J., Fernandes-Alnemri T., Huang Z., Alnemri E.S. J. Biol. Chem. 275:36152-36157(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION. |
| [3] | "Smac3, a novel Smac/DIABLO splicing variant, attenuates the stability and apoptosis-inhibiting activity of X-linked inhibitor of apoptosis protein." Fu J., Jin Y., Arend L.J. J. Biol. Chem. 278:52660-52672(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Stomach. |
| [5] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle and Uterus. |
| [7] | "Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase." Bartke T., Pohl C., Pyrowolakis G., Jentsch S. Mol. Cell 14:801-811(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BIRC6/BRUCE. |
| [8] | "Livin promotes Smac/DIABLO degradation by ubiquitin-proteasome pathway." Ma L., Huang Y., Song Z., Feng S., Tian X., Du W., Qiu X., Heese K., Wu M. Cell Death Differ. 13:2079-2088(2006) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY BIRC7/LIVIN, INTERACTION WITH BIRC7/LIVIN. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "Survivin monomer plays an essential role in apoptosis regulation." Pavlyukov M.S., Antipova N.V., Balashova M.V., Vinogradova T.V., Kopantzev E.P., Shakhparonov M.I. J. Biol. Chem. 286:23296-23307(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BIRC5/SURVIVIN. |
| [11] | "Structural and biochemical basis of apoptotic activation by Smac/DIABLO." Chai J., Du C., Wu J.W., Kyin S., Wang X., Shi Y. Nature 406:855-862(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 56-239. |
| [12] | "Structural basis for binding of Smac/DIABLO to the XIAP BIR3 domain." Liu Z., Sun C., Olejniczak E.T., Meadows R.P., Betz S.F., Oost T., Herrmann J., Wu J.C., Fesik S.W. Nature 408:1004-1008(2000) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 56-64 IN COMPLEX WITH XIAP. |
| [13] | "Functional mutation of SMAC/DIABLO, encoding a mitochondrial proapoptotic protein, causes human progressive hearing loss DFNA64." Cheng J., Zhu Y., He S., Lu Y., Chen J., Han B., Petrillo M., Wrzeszczynski K.O., Yang S., Dai P., Zhai S., Han D., Zhang M.Q., Li W., Liu X., Li H., Chen Z.Y., Yuan H. Am. J. Hum. Genet. 89:56-66(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNA64 LEU-126, CHARACTERIZATION OF DFNA64 LEU-126. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF262240 mRNA. Translation: AAF87716.1. AY313210 mRNA. Translation: AAQ86939.1. AK024768 mRNA. Translation: BAB14994.1. AK057778 mRNA. Translation: BAB71568.1. AK315629 mRNA. Translation: BAG37997.1. AF298770 mRNA. Translation: AAG22077.1. AC048338 Genomic DNA. No translation available. BC004417 mRNA. Translation: AAH04417.1. BC011909 mRNA. Translation: AAH11909.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00008418. IPI00219865. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_063940.1. NM_019887.4. NP_620307.1. NM_138929.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.169611. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-27627N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9NR28. 15 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-141675. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000267169. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 18203316. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 56616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000267169; ENSP00000267169; ENSG00000184047. ENST00000353548; ENSP00000320343; ENSG00000184047. ENST00000413918; ENSP00000411638; ENSG00000184047. ENST00000443649; ENSP00000398495; ENSG00000184047. ENST00000464942; ENSP00000442360; ENSG00000184047. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 56616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:56616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc010tab.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 56616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC12M122692. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:21528. DIABLO. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB003857. CAB016688. HPA001825. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 605219. gene. 614152. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 90635. Autosomal dominant nonsyndromic sensorineural deafness type DFNA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134945044. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG42122. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000217916. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG051315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K10522. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | AQKPEPH. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. p75ntrpathway. p75(NTR)-mediated signaling. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_DIABLO. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000184047. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR015142. Smac_DIABLO. IPR009062. Smac_DIABLO-like. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF09057. Smac_DIABLO. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF46984. Smac_Diablo. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | DIABLO. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 56616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 62059. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | DBLOH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NR28 Secondary accession number(s): B2RDQ0 Q9HAV6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with
