Reviewed,
UniProtKB/Swiss-Prot Q9NR28 (DBLOH_HUMAN)
Last modified
June 16, 2009.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Diablo homolog, mitochondrial Alternative name(s): Second mitochondria-derived activator of caspase Short name=Smac protein Direct IAP-binding protein with low pI | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 239 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Ref.1 |
| Subunit structure | Interacts with NGFRAP1/BEX3 By similarity. Homodimer. Interacts with BIRC2, BIRC3, XIAP and BIRC7. |
| Subcellular location | Mitochondrion. Note: But released into the cytosol when cells undergo apoptosis. |
| Tissue specificity | Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Ref.1 |
| Domain | The mature N-terminus mediates interaction with XIAP. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | activation of caspase activity by cytochrome c Ref.1 Traceable author statement. Source: ProtInc induction of apoptosis via death domain receptors Ref.3Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome mitochondrion Ref.1Inferred from direct assay. Source: HPA |
| Molecular function | protein binding Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BIRC2 | Q13490 | 2 | EBI-517508,EBI-514538 | |
| BIRC3 | Q13489 | 1 | EBI-517508,EBI-517709 | |
| BIRC7 | Q96CA5 | 5 | EBI-517508,EBI-517623 | |
| XIAP | P98170 | 5 | EBI-517508,EBI-517127 | |
| Xiap | Q60989 | 2 | EBI-517508,EBI-517478 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NR28-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NR28-2) Also known as: Diablo-S; The sequence of this isoform differs from the canonical sequence as follows: 1-60: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA → MKSDFYF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||
Molecule processing | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 55 | 55 | Mitochondrion | |||||||||||||
| Chain | 56 – 239 | 184 | Diablo homolog, mitochondrial | PRO_0000021072 | ||||||||||||
Regions | ||||||||||||||||
| Motif | 56 – 60 | 5 | IAP-binding motif By similarity | |||||||||||||
Natural variations | ||||||||||||||||
| Alternative sequence | 1 – 60 | 60 | MAALK…AVPIA → MKSDFYF in isoform 2. | VSP_004397 | ||||||||||||
Experimental info | ||||||||||||||||
| Sequence conflict | 32 | 1 | K → E in BAB71568. Ref.2 | |||||||||||||
| Sequence conflict | 44 | 1 | K → R in BAB14994. Ref.2 | |||||||||||||
| Sequence conflict | 62 – 105 | 44 | Missing in BAB71568. Ref.2 | |||||||||||||
| Sequence conflict | 165 | 1 | E → K in BAB71568. Ref.2 | |||||||||||||
Secondary structure | ||||||||||||||||
Helix Strand Turn | ||||||||||||||||
| Helix | 68 – 120 | 53 | ||||||||||||||
| Beta strand | 123 – 125 | 3 | ||||||||||||||
| Helix | 126 – 173 | 48 | ||||||||||||||
| Helix | 177 – 236 | 60 | ||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Smac, a mitochondrial protein that promotes cytochrome c-dependent caspase activation by eliminating IAP inhibition." Du C., Fang M., Li Y., Li L., Wang X. Cell 102:33-42(2000) [PubMed: 10929711] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Stomach. |
| [3] | "Molecular determinants of the caspase-promoting activity of Smac/DIABLO and its role in the death receptor pathway." Srinivasula S.M., Datta P., Fan X.J., Fernandes-Alnemri T., Huang Z., Alnemri E.S. J. Biol. Chem. 275:36152-36157(2000) [PubMed: 10950947] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle and Uterus. |
| [5] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [6] | "Structural and biochemical basis of apoptotic activation by Smac/DIABLO." Chai J., Du C., Wu J.W., Kyin S., Wang X., Shi Y. Nature 406:855-862(2000) [PubMed: 10972280] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 56-239. |
| [7] | "Structural basis for binding of Smac/DIABLO to the XIAP BIR3 domain." Liu Z., Sun C., Olejniczak E.T., Meadows R.P., Betz S.F., Oost T., Herrmann J., Wu J.C., Fesik S.W. Nature 408:1004-1008(2000) [PubMed: 11140637] [Abstract] Cited for: STRUCTURE BY NMR OF 56-64 IN COMPLEX WITH XIAP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF262240 mRNA. Translation: AAF87716.1. AK024768 mRNA. Translation: BAB14994.1. AK057778 mRNA. Translation: BAB71568.1. AK315629 mRNA. Translation: BAG37997.1. AF298770 mRNA. Translation: AAG22077.1. BC004417 mRNA. Translation: AAH04417.1. BC011909 mRNA. Translation: AAH11909.1. | |||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00008418. IPI00219865. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_063940.1. NP_620307.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.169611 | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP:27627N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9NR28. 7 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000184047. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 56616. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:56616. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC12M121258. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0018494. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:21528. DIABLO. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB003857. CAB016688. HPA001825. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 605219. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134945044. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | Q9NR28. HIQLVKL. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. p75ntrpathway. p75(NTR)-mediated signaling. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_DIABLO. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000184047. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR015142. Smac_DIABLO. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF09057. Smac_DIABLO. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 62059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q9NR28. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | DBLOH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NR28 Secondary accession number(s): B2RDQ0 Q9HAV6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with


