Q9NQX3 (GEPH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Gephyrin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 736 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Microtubule-associated protein involved in membrane protein-cytoskeleton interactions. It is thought to anchor the inhibitory glycine receptor (GLYR) to subsynaptic microtubules By similarity. Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released. |
| Catalytic activity | ATP + molybdopterin = diphosphate + adenylyl-molybdopterin. Adenylyl-molybdopterin + molybdate = molybdenum cofactor + AMP. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Inhibited by copper and tungsten By similarity. |
| Pathway | |
| Subunit structure | Homotrimer. Interacts with GABARAP By similarity. Ref.9 |
| Subcellular location | Cell junction › synapse By similarity. Cell junction › synapse › postsynaptic cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cytoplasm › cytoskeleton By similarity. Note: Cytoplasmic face of glycinergic postsynaptic membranes By similarity. |
| Involvement in disease | Defects in GPHN are the cause of molybdenum cofactor deficiency type C (MOCOD type C) [MIM:252150]. MOCOD type C is an autosomal recessive disease which leads to the pleiotropic loss of all molybdoenzyme activities and is characterized by severe neurological damage, neonatal seizures and early childhood death. Ref.1 Defects in GPHN are a cause of startle disease (STHE) [MIM:149400]; also known as hyperekplexia. STHE is a genetically heterogeneous neurologic disorder characterized by muscular rigidity of central nervous system origin, particularly in the neonatal period, and by an exaggerated startle response to unexpected acoustic or tactile stimuli. Ref.1 Ref.10 |
| Sequence similarities | In the N-terminal section; belongs to the MoaB/Mog family. In the C-terminal section; belongs to the moeA family. |
| Sequence caution | The sequence BAA92623.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NQX3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NQX3-2) The sequence of this isoform differs from the canonical sequence as follows: 243-243: K → KKHPFYTSPAVVMAHGEQPIPGLINYSHHSTDER |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 736 | 736 | Gephyrin | PRO_0000170964 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Region | 14 – 166 | 153 | MPT Mo-transferase | ||||||||||||||||||||||||||||||||||||||||
| Region | 140 – 316 | 177 | Interaction with GABARAP By similarity | ||||||||||||||||||||||||||||||||||||||||
| Region | 326 – 736 | 411 | MPT adenylyltransferase | ||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 188 | 1 | Phosphoserine Ref.7 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 194 | 1 | Phosphoserine Ref.7 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 266 | 1 | Phosphothreonine Ref.5 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 270 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 286 | 1 | Phosphothreonine Ref.5 Ref.6 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 305 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 243 | 1 | K → KKHPFYTSPAVVMAHGEQPI PGLINYSHHSTDER in isoform 2. | VSP_021769 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 10 | 1 | N → Y in STHE; sporadic case. Ref.10 | VAR_044162 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 16 – 22 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 24 – 27 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 34 – 44 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 46 – 49 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 52 – 59 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 75 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 80 – 86 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 91 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 96 – 103 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 105 – 107 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 122 | 14 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 124 – 128 | 5 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 136 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 144 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 158 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 159 – 161 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 169 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 178 | 4 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A mutation in the gene for the neurotransmitter receptor-clustering protein gephyrin causes a novel form of molybdenum cofactor deficiency." Reiss J., Gross-Hardt S., Christensen E., Schmidt P., Mendel R.R., Schwarz G. Am. J. Hum. Genet. 68:208-213(2001) [PubMed: 11095995] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE. |
| [2] | "The human gephyrin (GPHN) gene: structure, chromosome localization and expression in non-neuronal cells." David-Watine B. Gene 271:239-245(2001) [PubMed: 11418245] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Kidney. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-266 AND THR-286, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-270 AND THR-286, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188 AND SER-194, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "Crystal structures of human gephyrin and plant Cnx1 G domains: comparative analysis and functional implications." Schwarz G., Schrader N., Mendel R.R., Hecht H.-J., Schindelin H. J. Mol. Biol. 312:405-418(2001) [PubMed: 11554796] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 1-181, SUBUNIT. |
| [10] | "Isoform heterogeneity of the human gephyrin gene (GPHN), binding domains to the glycine receptor, and mutation analysis in hyperekplexia." Rees M.I., Harvey K., Ward H., White J.H., Evans L., Duguid I.C., Hsu C.-C., Coleman S.L., Miller J., Baer K., Waldvogel H.J., Gibbon F., Smart T.G., Owen M.J., Harvey R.J., Snell R.G. J. Biol. Chem. 278:24688-24696(2003) [PubMed: 12684523] [Abstract] Cited for: VARIANT STHE TYR-10. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF272663 mRNA. Translation: AAF81785.1. AJ272343 mRNA. Translation: CAC10537.1. AB037806 mRNA. Translation: BAA92623.1. Different initiation. BC030016 mRNA. Translation: AAH30016.1. | ||||||||||||
| IPI | IPI00016006. IPI00184477. | ||||||||||||
| RefSeq | NP_001019389.1. NM_001024218.1. NP_065857.1. NM_020806.4. | ||||||||||||
| UniGene | Hs.208765. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NQX3. | ||||||||||||
| SMR | Q9NQX3. Positions 13-181, 318-736. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NQX3. 8 interactions. | ||||||||||||
| STRING | Q9NQX3. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NQX3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 13431554. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NQX3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000315266; ENSP00000312771; ENSG00000171723. | ||||||||||||
| GeneID | 10243. | ||||||||||||
| KEGG | hsa:10243. | ||||||||||||
| UCSC | uc001xix.1. human. uc001xiy.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10243. | ||||||||||||
| GeneCards | GC14P066974. | ||||||||||||
| HGNC | HGNC:15465. GPHN. | ||||||||||||
| HPA | CAB004419. HPA003116. HPA024694. | ||||||||||||
| MIM | 149400. phenotype. 252150. phenotype. 603930. gene. | ||||||||||||
| neXtProt | NX_Q9NQX3. | ||||||||||||
| Orphanet | 833. Encephalopathy due to sulfite oxidase deficiency. 3197. Hereditary hyperekplexia. | ||||||||||||
| PharmGKB | PA28840. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000016577. | ||||||||||||
| HOVERGEN | HBG005828. | ||||||||||||
| OMA | RDVTPEX. | ||||||||||||
| OrthoDB | EOG4N30NB. | ||||||||||||
| PhylomeDB | Q9NQX3. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NQX3. | ||||||||||||
| Bgee | Q9NQX3. | ||||||||||||
| CleanEx | HS_GPHN. | ||||||||||||
| Genevestigator | Q9NQX3. | ||||||||||||
| GermOnline | ENSG00000171723. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR020817. Mo_cofactor_synthesis. IPR008284. MoCF_biosynth_CS. IPR005111. MoeA_C_domain_IV. IPR005110. MoeA_linker/N. IPR001453. Mopterin-bd. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.40.340.10. G3DSA:2.40.340.10. 1 hit. G3DSA:3.40.980.10. MPT_bd. 2 hits. | ||||||||||||
| KO | K15376. | ||||||||||||
| Pfam | PF00994. MoCF_biosynth. 2 hits. PF03454. MoeA_C. 1 hit. PF03453. MoeA_N. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00852. MoCF_biosynth. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF53218. MoCF_biosynth. 2 hits. SSF63867. MoeA_C. 1 hit. SSF63882. MoeA_N. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR00177. Molyb_syn. 2 hits. | ||||||||||||
| PROSITE | PS01078. MOCF_BIOSYNTHESIS_1. 1 hit. PS01079. MOCF_BIOSYNTHESIS_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 38806. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | GEPH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQX3 Secondary accession number(s): Q9H4E9, Q9P2G2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with