Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NQS3

- PVRL3_HUMAN

UniProt

Q9NQS3 - PVRL3_HUMAN

Protein

Nectin-3

Gene

PVRL3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/nectin-2 at Sertoli-spermatid junctions. Trans-interaction with PVR induces activation of CDC42 and RAC small G proteins through common signaling molecules such as SRC and RAP1. Also involved in the formation of cell-cell junctions, including adherens junctions and synapses. Induces endocytosis-mediated down-regulation of PVR from the cell surface, resulting in reduction of cell movement and proliferation. Plays a role in the morphology of the ciliary body.1 Publication

    GO - Molecular functioni

    1. cell adhesion molecule binding Source: BHF-UCL
    2. protein binding Source: UniProtKB
    3. protein homodimerization activity Source: HGNC

    GO - Biological processi

    1. adherens junction organization Source: Reactome
    2. cell-cell junction organization Source: Reactome
    3. cell junction assembly Source: Reactome
    4. fertilization Source: Ensembl
    5. homophilic cell adhesion Source: HGNC
    6. lens morphogenesis in camera-type eye Source: Ensembl
    7. retina morphogenesis in camera-type eye Source: Ensembl
    8. single organismal cell-cell adhesion Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_19195. Adherens junctions interactions.
    REACT_19268. Nectin/Necl trans heterodimerization.

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nectin-3
    Alternative name(s):
    CDw113
    Poliovirus receptor-related protein 3
    CD_antigen: CD113
    Gene namesi
    Name:PVRL3
    Synonyms:PRR3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:17664. PVRL3.

    Subcellular locationi

    GO - Cellular componenti

    1. apical junction complex Source: Ensembl
    2. cell-cell adherens junction Source: Ensembl
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: HGNC
    5. postsynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134969621.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 5757Sequence AnalysisAdd
    BLAST
    Chaini58 – 549492Nectin-3PRO_0000226372Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi73 – 731N-linked (GlcNAc...)1 Publication
    Disulfide bondi78 ↔ 148PROSITE-ProRule annotation
    Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi125 – 1251N-linked (GlcNAc...)1 Publication
    Glycosylationi186 – 1861N-linked (GlcNAc...)1 Publication
    Disulfide bondi193 ↔ 246PROSITE-ProRule annotation
    Glycosylationi222 – 2221N-linked (GlcNAc...)1 Publication
    Disulfide bondi291 ↔ 338PROSITE-ProRule annotation
    Glycosylationi331 – 3311N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ9NQS3.
    PaxDbiQ9NQS3.
    PRIDEiQ9NQS3.

    PTM databases

    PhosphoSiteiQ9NQS3.

    Expressioni

    Tissue specificityi

    Predominantly expressed in testis and placenta as well as in many cell lines, including epithelial cell lines.1 Publication

    Gene expression databases

    ArrayExpressiQ9NQS3.
    BgeeiQ9NQS3.
    CleanExiHS_PRR3.
    HS_PVRL3.
    GenevestigatoriQ9NQS3.

    Organism-specific databases

    HPAiCAB009869.
    HPA011038.
    HPA052242.

    Interactioni

    Subunit structurei

    Cis- and trans-homodimer. Can form trans-heterodimers with PVRL1/nectin-1, PVRL2/nectin-2, PVR, IGSF4B/Necl-1 and with IGSF4. Interaction between PVRL1 and PVRL3 on the pre- and postsynaptic sites, respectively, initiates the formation of puncta adherentia junctions between axons and dendrites. Interacts (via Cytoplasmic domain) with MLLT4/afadin, providing a connection with the actin cytoskeleton. Binds with low affinity to TIGIT.5 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PVRL1Q152232EBI-2826725,EBI-1771314
    PVRL2Q926923EBI-2826725,EBI-718419
    TIGITQ495A12EBI-2826725,EBI-4314807

    Protein-protein interaction databases

    BioGridi117441. 9 interactions.
    DIPiDIP-41491N.
    IntActiQ9NQS3. 5 interactions.
    MINTiMINT-147327.
    STRINGi9606.ENSP00000418070.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4FOMX-ray3.93A58-359[»]
    ProteinModelPortaliQ9NQS3.
    SMRiQ9NQS3. Positions 58-359.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini58 – 404347ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini426 – 549124CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei405 – 42521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini59 – 165107Ig-like V-typeAdd
    BLAST
    Domaini170 – 25889Ig-like C2-type 1Add
    BLAST
    Domaini269 – 35486Ig-like C2-type 2Add
    BLAST

    Sequence similaritiesi

    Belongs to the nectin family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG47602.
    HOGENOMiHOG000115805.
    HOVERGENiHBG082234.
    InParanoidiQ9NQS3.
    KOiK06592.
    OrthoDBiEOG73RBB5.
    PhylomeDBiQ9NQS3.
    TreeFamiTF331051.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 3 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NQS3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARTLRPSPL CPGGGKAQLS SASLLGAGLL LQPPTPPPLL LLLFPLLLFS    50
    RLCGALAGPI IVEPHVTAVW GKNVSLKCLI EVNETITQIS WEKIHGKSSQ 100
    TVAVHHPQYG FSVQGEYQGR VLFKNYSLND ATITLHNIGF SDSGKYICKA 150
    VTFPLGNAQS STTVTVLVEP TVSLIKGPDS LIDGGNETVA AICIAATGKP 200
    VAHIDWEGDL GEMESTTTSF PNETATIISQ YKLFPTRFAR GRRITCVVKH 250
    PALEKDIRYS FILDIQYAPE VSVTGYDGNW FVGRKGVNLK CNADANPPPF 300
    KSVWSRLDGQ WPDGLLASDN TLHFVHPLTF NYSGVYICKV TNSLGQRSDQ 350
    KVIYISDPPT TTTLQPTIQW HPSTADIEDL ATEPKKLPFP LSTLATIKDD 400
    TIATIIASVV GGALFIVLVS VLAGIFCYRR RRTFRGDYFA KNYIPPSDMQ 450
    KESQIDVLQQ DELDSYPDSV KKENKNPVNN LIRKDYLEEP EKTQWNNVEN 500
    LNRFERPMDY YEDLKMGMKF VSDEHYDENE DDLVSHVDGS VISRREWYV 549
    Length:549
    Mass (Da):61,002
    Last modified:October 1, 2000 - v1
    Checksum:i6D1104CCB4A9D731
    GO
    Isoform 2 (identifier: Q9NQS3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         357-366: DPPTTTTLQP → AYNSVASLNC
         367-549: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:366
    Mass (Da):39,692
    Checksum:i091C0A4640DB8661
    GO
    Isoform 3 (identifier: Q9NQS3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-54: MARTLRPSPL...PLLLFSRLCG → MAEGWRWCFVRRTPGLLRGPLLPRSFSGNPR
         357-549: DPPTTTTLQP...SVISRREWYV → DVPFKQTSSI...VYIDPREHYV

    Show »
    Length:487
    Mass (Da):54,375
    Checksum:iA59BE81140C93511
    GO

    Sequence cautioni

    The sequence AAH17572.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    Isoform 3 : The sequence BAC11404.1 differs from that shown. Reason: Erroneous termination at position 268. Translated as Cys.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti251 – 2511P → Q in AAH67808. (PubMed:15489334)Curated
    Sequence conflicti284 – 2841R → G in BAC11404. (PubMed:14702039)Curated
    Sequence conflicti386 – 3861K → E in AAH17572. (PubMed:15489334)Curated
    Sequence conflicti465 – 4651S → P in CAB43256. (PubMed:17974005)Curated
    Sequence conflicti519 – 5191K → R in CAB43256. (PubMed:17974005)Curated
    Sequence conflicti548 – 5481Y → C in CAB43256. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti432 – 4321R → L.
    Corresponds to variant rs15611 [ dbSNP | Ensembl ].
    VAR_049995

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5454MARTL…SRLCG → MAEGWRWCFVRRTPGLLRGP LLPRSFSGNPR in isoform 3. 1 PublicationVSP_046893Add
    BLAST
    Alternative sequencei357 – 549193DPPTT…REWYV → DVPFKQTSSIAVAGAVIGAV LALFIIAIFVTVLLTPRKKR PSYLDKVIDLPPTHKPPPLY EERSPPLPQKDLFQPEHLPL QTQFKEREVGNLQHSNGLNS RSFDYEDENPVGEDGIQQMY PLYNQMCYQDRSPGKHHQNN DPKRVYIDPREHYV in isoform 3. 1 PublicationVSP_046894Add
    BLAST
    Alternative sequencei357 – 36610DPPTTTTLQP → AYNSVASLNC in isoform 2. 1 PublicationVSP_017435
    Alternative sequencei367 – 549183Missing in isoform 2. 1 PublicationVSP_017436Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF282874 mRNA. Translation: AAF97597.1.
    AK075105 mRNA. Translation: BAC11404.1. Different termination.
    AC133436 Genomic DNA. No translation available.
    AC133477 Genomic DNA. No translation available.
    AC137833 Genomic DNA. No translation available.
    BC001336 mRNA. Translation: AAH01336.1.
    BC017572 mRNA. Translation: AAH17572.1. Different initiation.
    BC067808 mRNA. Translation: AAH67808.1.
    AL050071 mRNA. Translation: CAB43256.1.
    CCDSiCCDS2957.1. [Q9NQS3-1]
    CCDS58842.1. [Q9NQS3-2]
    CCDS58843.1. [Q9NQS3-3]
    PIRiT08732.
    RefSeqiNP_001230215.1. NM_001243286.1. [Q9NQS3-2]
    NP_001230217.1. NM_001243288.1. [Q9NQS3-3]
    NP_056295.1. NM_015480.2. [Q9NQS3-1]
    UniGeneiHs.293917.

    Genome annotation databases

    EnsembliENST00000319792; ENSP00000321514; ENSG00000177707. [Q9NQS3-2]
    ENST00000485303; ENSP00000418070; ENSG00000177707. [Q9NQS3-1]
    ENST00000493615; ENSP00000420579; ENSG00000177707. [Q9NQS3-3]
    GeneIDi25945.
    KEGGihsa:25945.
    UCSCiuc003dxt.2. human. [Q9NQS3-1]
    uc021xch.1. human. [Q9NQS3-2]

    Polymorphism databases

    DMDMi74762752.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF282874 mRNA. Translation: AAF97597.1 .
    AK075105 mRNA. Translation: BAC11404.1 . Different termination.
    AC133436 Genomic DNA. No translation available.
    AC133477 Genomic DNA. No translation available.
    AC137833 Genomic DNA. No translation available.
    BC001336 mRNA. Translation: AAH01336.1 .
    BC017572 mRNA. Translation: AAH17572.1 . Different initiation.
    BC067808 mRNA. Translation: AAH67808.1 .
    AL050071 mRNA. Translation: CAB43256.1 .
    CCDSi CCDS2957.1. [Q9NQS3-1 ]
    CCDS58842.1. [Q9NQS3-2 ]
    CCDS58843.1. [Q9NQS3-3 ]
    PIRi T08732.
    RefSeqi NP_001230215.1. NM_001243286.1. [Q9NQS3-2 ]
    NP_001230217.1. NM_001243288.1. [Q9NQS3-3 ]
    NP_056295.1. NM_015480.2. [Q9NQS3-1 ]
    UniGenei Hs.293917.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4FOM X-ray 3.93 A 58-359 [» ]
    ProteinModelPortali Q9NQS3.
    SMRi Q9NQS3. Positions 58-359.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117441. 9 interactions.
    DIPi DIP-41491N.
    IntActi Q9NQS3. 5 interactions.
    MINTi MINT-147327.
    STRINGi 9606.ENSP00000418070.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei Q9NQS3.

    Polymorphism databases

    DMDMi 74762752.

    Proteomic databases

    MaxQBi Q9NQS3.
    PaxDbi Q9NQS3.
    PRIDEi Q9NQS3.

    Protocols and materials databases

    DNASUi 25945.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000319792 ; ENSP00000321514 ; ENSG00000177707 . [Q9NQS3-2 ]
    ENST00000485303 ; ENSP00000418070 ; ENSG00000177707 . [Q9NQS3-1 ]
    ENST00000493615 ; ENSP00000420579 ; ENSG00000177707 . [Q9NQS3-3 ]
    GeneIDi 25945.
    KEGGi hsa:25945.
    UCSCi uc003dxt.2. human. [Q9NQS3-1 ]
    uc021xch.1. human. [Q9NQS3-2 ]

    Organism-specific databases

    CTDi 25945.
    GeneCardsi GC03P110788.
    HGNCi HGNC:17664. PVRL3.
    HPAi CAB009869.
    HPA011038.
    HPA052242.
    MIMi 607147. gene.
    neXtProti NX_Q9NQS3.
    PharmGKBi PA134969621.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47602.
    HOGENOMi HOG000115805.
    HOVERGENi HBG082234.
    InParanoidi Q9NQS3.
    KOi K06592.
    OrthoDBi EOG73RBB5.
    PhylomeDBi Q9NQS3.
    TreeFami TF331051.

    Enzyme and pathway databases

    Reactomei REACT_19195. Adherens junctions interactions.
    REACT_19268. Nectin/Necl trans heterodimerization.

    Miscellaneous databases

    ChiTaRSi PVRL3. human.
    GeneWikii PVRL3.
    GenomeRNAii 25945.
    NextBioi 47534.
    PROi Q9NQS3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NQS3.
    Bgeei Q9NQS3.
    CleanExi HS_PRR3.
    HS_PVRL3.
    Genevestigatori Q9NQS3.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human nectin3/PRR3: a novel member of the PVR/PRR/nectin family that interacts with afadin."
      Reymond N., Borg J.-P., Lecocq E., Adelaide J., Campadelli-Fiume G., Dubreuil P., Lopez M.
      Gene 255:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH MLLT4.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Placenta.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 246-549 (ISOFORM 1).
      Tissue: Brain, Cervix and Kidney.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 143-549 (ISOFORM 1).
      Tissue: Fetal kidney.
    6. "Recruitment of nectin-3 to cell-cell junctions through trans-heterophilic interaction with CD155, a vitronectin and poliovirus receptor that localizes to alpha(v)beta3 integrin-containing membrane microdomains."
      Mueller S., Wimmer E.
      J. Biol. Chem. 278:31251-31260(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PVR.
    7. "Inhibition of cell movement and proliferation by cell-cell contact-induced interaction of Necl-5 with nectin-3."
      Fujito T., Ikeda W., Kakunaga S., Minami Y., Kajita M., Sakamoto Y., Monden M., Takai Y.
      J. Cell Biol. 171:165-173(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH PVR.
    8. "The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells."
      Yu X., Harden K., Gonzalez L.C., Francesco M., Chiang E., Irving B., Tom I., Ivelja S., Refino C.J., Clark H., Eaton D., Grogan J.L.
      Nat. Immunol. 10:48-57(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TIGIT.
    9. Cited for: X-RAY CRYSTALLOGRAPHY (3.93 ANGSTROMS) OF 58-359, SUBUNIT, GLYCOSYLATION AT ASN-73; ASN-125; ASN-186; ASN-222 AND ASN-331, IDENTIFICATION BY MASS SPECTROMETRY.

    Entry informationi

    Entry nameiPVRL3_HUMAN
    AccessioniPrimary (citable) accession number: Q9NQS3
    Secondary accession number(s): E9PFR0
    , Q6NVZ3, Q8NC05, Q8WVU4, Q9BVA9, Q9Y412
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3