Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NQB0

- TF7L2_HUMAN

UniProt

Q9NQB0 - TF7L2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor 7-like 2

Gene

TCF7L2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine.5 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi350 – 41869HMG boxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. armadillo repeat domain binding Source: BHF-UCL
  2. beta-catenin binding Source: BHF-UCL
  3. chromatin binding Source: RefGenome
  4. gamma-catenin binding Source: BHF-UCL
  5. nuclear hormone receptor binding Source: BHF-UCL
  6. protein kinase binding Source: UniProtKB
  7. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: BHF-UCL
  8. RNA polymerase II repressing transcription factor binding Source: BHF-UCL
  9. sequence-specific DNA binding Source: UniProtKB
  10. sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  11. transcription factor binding Source: BHF-UCL
  12. transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

  1. blood vessel development Source: BHF-UCL
  2. bone mineralization Source: Ensembl
  3. brain development Source: RefGenome
  4. canonical Wnt signaling pathway Source: BHF-UCL
  5. canonical Wnt signaling pathway involved in positive regulation of epithelial to mesenchymal transition Source: BHF-UCL
  6. catenin import into nucleus Source: Ensembl
  7. cell cycle arrest Source: BHF-UCL
  8. cell proliferation Source: BHF-UCL
  9. cellular response to starvation Source: Ensembl
  10. embryonic digestive tract morphogenesis Source: Ensembl
  11. embryonic genitalia morphogenesis Source: Ensembl
  12. embryonic hindgut morphogenesis Source: Ensembl
  13. face morphogenesis Source: Ensembl
  14. fat cell differentiation Source: BHF-UCL
  15. generation of neurons Source: RefGenome
  16. glucose homeostasis Source: BHF-UCL
  17. glucose metabolic process Source: Ensembl
  18. glycogen metabolic process Source: Ensembl
  19. insulin metabolic process Source: Ensembl
  20. maintenance of DNA repeat elements Source: BHF-UCL
  21. multicellular organism growth Source: Ensembl
  22. myoblast fate commitment Source: BHF-UCL
  23. negative regulation of BMP signaling pathway Source: Ensembl
  24. negative regulation of canonical Wnt signaling pathway Source: UniProtKB
  25. negative regulation of extrinsic apoptotic signaling pathway Source: BHF-UCL
  26. negative regulation of fat cell differentiation Source: Ensembl
  27. negative regulation of fibroblast growth factor receptor signaling pathway Source: Ensembl
  28. negative regulation of organ growth Source: Ensembl
  29. negative regulation of sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  30. negative regulation of transcription, DNA-templated Source: UniProtKB
  31. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  32. negative regulation of type B pancreatic cell apoptotic process Source: BHF-UCL
  33. neural tube development Source: Ensembl
  34. odontogenesis of dentin-containing tooth Source: Ensembl
  35. oligodendrocyte development Source: Ensembl
  36. pancreas development Source: BHF-UCL
  37. pituitary gland development Source: Ensembl
  38. positive regulation of apoptotic process Source: Ensembl
  39. positive regulation of epithelial cell proliferation Source: Ensembl
  40. positive regulation of gluconeogenesis Source: Ensembl
  41. positive regulation of heparan sulfate proteoglycan biosynthetic process Source: BHF-UCL
  42. positive regulation of insulin secretion Source: BHF-UCL
  43. positive regulation of protein binding Source: BHF-UCL
  44. positive regulation of protein export from nucleus Source: BHF-UCL
  45. positive regulation of protein kinase B signaling Source: BHF-UCL
  46. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  47. positive regulation of triglyceride biosynthetic process Source: Ensembl
  48. post-embryonic development Source: Ensembl
  49. regulation of hormone metabolic process Source: BHF-UCL
  50. regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
  51. regulation of myelination Source: Ensembl
  52. regulation of oligodendrocyte differentiation Source: Ensembl
  53. regulation of skeletal muscle tissue development Source: Ensembl
  54. regulation of smooth muscle cell proliferation Source: BHF-UCL
  55. regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  56. response to glucose Source: BHF-UCL
  57. secretory granule localization Source: Ensembl
  58. skin development Source: Ensembl
  59. somatic stem cell maintenance Source: Ensembl
  60. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation, Wnt signaling pathway

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_172761. Ca2+ pathway.
REACT_200731. deactivation of the beta-catenin transactivating complex.
REACT_200753. formation of the beta-catenin:TCF transactivating complex.
REACT_200799. binding of TCF/LEF:CTNNB1 to target gene promoters.
REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).
SignaLinkiQ9NQB0.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor 7-like 2
Alternative name(s):
HMG box transcription factor 4
T-cell-specific transcription factor 4
Short name:
T-cell factor 4
Short name:
TCF-4
Short name:
hTCF-4
Gene namesi
Name:TCF7L2
Synonyms:TCF4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:11641. TCF7L2.

Subcellular locationi

NucleusPML body 3 Publications
Note: Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies.

GO - Cellular componenti

  1. beta-catenin-TCF7L2 complex Source: BHF-UCL
  2. cytoplasm Source: HPA
  3. nuclear chromatin Source: BHF-UCL
  4. nucleoplasm Source: BHF-UCL
  5. nucleus Source: UniProtKB
  6. protein-DNA complex Source: BHF-UCL
  7. transcription factor complex Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Constitutive activation and subsequent transactivation of target genes may lead to the maintenance of stem-cell characteristics (cycling and longevity) in cells that should normally undergo terminal differentiation and constitute the primary transforming event in colorectal cancer (CRC).
Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.2 Publications
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi10 – 112DD → AA: Reduces CTNNB1 binding. 1 Publication
Mutagenesisi16 – 161D → A: Abolishes CTNNB1 binding. 1 Publication
Mutagenesisi17 – 171E → A: Reduces CTNNB1 binding. 1 Publication
Mutagenesisi19 – 191I → A: Reduces transcription activation. 1 Publication
Mutagenesisi21 – 211F → A: Reduces transcription activation. 1 Publication
Mutagenesisi23 – 242DE → AA: Reduces CTNNB1 binding. 1 Publication
Mutagenesisi24 – 241E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-26; A-28 and A-29. 1 Publication
Mutagenesisi26 – 261E → A: Abolishes CTNNB1 binding; when associated with A-24; A-28 and A-29. 1 Publication
Mutagenesisi28 – 281E → A: Abolishes CTNNB1 binding; when associated with A-24; A-26 and A-29. 1 Publication
Mutagenesisi29 – 291E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-24; A-26 and A-28. 1 Publication
Mutagenesisi48 – 481L → A: Abolishes CTNNB1 binding. 1 Publication
Mutagenesisi201 – 2011T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-212. 1 Publication
Mutagenesisi212 – 2121T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-201. 1 Publication
Mutagenesisi320 – 3201K → R: Loss of sumoylation. No effect on localization to nuclear bodies. 1 Publication
Mutagenesisi322 – 3221E → A: Loss of sumoylation. 1 Publication

Keywords - Diseasei

Diabetes mellitus

Organism-specific databases

MIMi125853. phenotype.
PharmGKBiPA36394.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 619619Transcription factor 7-like 2PRO_0000048623Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei201 – 2011Phosphothreonine; by NLK1 Publication
Modified residuei212 – 2121Phosphothreonine; by NLK1 Publication
Cross-linki320 – 320Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)

Post-translational modificationi

In vitro, phosphorylated by TNIK.1 Publication
Phosphorylated at Thr-201 and/or Thr-212 by NLK. Phosphorylation by NLK at these sites inhibits DNA-binding by TCF7L2/TCF4, thereby preventing transcriptional activation of target genes of the canonical Wnt/beta-catenin signaling pathway.1 Publication
Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylation is enhanced by SENP2. Sumoylation/desumoylation regulates TCF7L2/TCF4 transcription activity in the Wnt/beta-catenin signaling pathway without altering interaction with CTNNB1 nor binding to DNA.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ9NQB0.
PaxDbiQ9NQB0.
PRIDEiQ9NQB0.

PTM databases

PhosphoSiteiQ9NQB0.

Expressioni

Tissue specificityi

Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom.1 Publication

Developmental stagei

Highly expressed in crypt regions and barely detectable in villi in epithelium from fetal small intestine at week 16. At week 22 expression in villi had increased strongly.

Gene expression databases

BgeeiQ9NQB0.
CleanExiHS_TCF4.
ExpressionAtlasiQ9NQB0. baseline and differential.
GenevestigatoriQ9NQB0.

Organism-specific databases

HPAiCAB013535.
HPA038800.

Interactioni

Subunit structurei

Interacts with TGFB1I1 (By similarity). Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex. Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1. Interacts with TNIK. Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity. Interacts with ZIPK/DAPK3. Interacts with XIAP/BIRC4 and TLE3. Interacts with DDIT3/CHOP. The CTNNB1 and TCF7L2/TCF4 complex interacts with PML (isoform PML-4). Identified in a complex with CTNNB1 and FERMT2. Interacts with SPIN1.By similarity19 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CTNNB1P3522230EBI-924724,EBI-491549
DAXXQ9UER75EBI-924724,EBI-77321
HIC1Q145266EBI-924724,EBI-2507362
JUPP1492313EBI-924724,EBI-702484
RUNX3Q1376114EBI-924724,EBI-925990
TNIKQ9UKE53EBI-924724,EBI-1051794
XRCC6P129569EBI-924724,EBI-353208

Protein-protein interaction databases

BioGridi112795. 22 interactions.
DIPiDIP-36236N.
IntActiQ9NQB0. 32 interactions.
MINTiMINT-222146.

Structurei

Secondary structure

1
619
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi22 – 3110
Helixi38 – 4811

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1JDHX-ray1.90B12-49[»]
1JPWX-ray2.50D/E/F6-54[»]
2GL7X-ray2.60B/E1-53[»]
DisProtiDP00175.
ProteinModelPortaliQ9NQB0.
SMRiQ9NQB0. Positions 12-49, 349-424.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NQB0.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 5353CTNNB1-bindingBy similarityAdd
BLAST
Regioni201 – 395195Mediates interaction with MAD2L2Add
BLAST
Regioni459 – 50547Promoter-specific activation domainAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi425 – 4306Nuclear localization signalSequence Analysis

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi178 – 317140Pro-richAdd
BLAST

Domaini

The promoter-specific activation domain interacts with the transcriptional coactivator EP300.

Sequence similaritiesi

Belongs to the TCF/LEF family.Curated
Contains 1 HMG box DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG252916.
GeneTreeiENSGT00390000009964.
HOVERGENiHBG000419.
InParanoidiQ9NQB0.
KOiK04491.
OMAiEPWCLES.
OrthoDBiEOG7QNVMG.
PhylomeDBiQ9NQB0.
TreeFamiTF318448.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
4.10.900.10. 1 hit.
InterProiIPR027397. Catenin_binding_dom.
IPR013558. CTNNB1-bd_N.
IPR009071. HMG_box_dom.
IPR024940. TCF/LEF.
IPR028773. TCF7L2.
[Graphical view]
PANTHERiPTHR10373. PTHR10373. 1 hit.
PTHR10373:SF32. PTHR10373:SF32. 1 hit.
PfamiPF08347. CTNNB1_binding. 1 hit.
PF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]

Sequences (17)i

Sequence statusi: Complete.

This entry describes 17 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NQB0-1) [UniParc]FASTAAdd to Basket

Also known as: TCF-4M

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPQLNGGGGD DLGANDELIS FKDEGEQEEK SSENSSAERD LADVKSSLVN
60 70 80 90 100
ESETNQNSSS DSEAERRPPP RSESFRDKSR ESLEEAAKRQ DGGLFKGPPY
110 120 130 140 150
PGYPFIMIPD LTSPYLPNGS LSPTARTLHF QSGSTHYSAY KTIEHQIAVQ
160 170 180 190 200
YLQMKWPLLD VQAGSLQSRQ ALKDARSPSP AHIVSNKVPV VQHPHHVHPL
210 220 230 240 250
TPLITYSNEH FTPGNPPPHL PADVDPKTGI PRPPHPPDIS PYYPLSPGTV
260 270 280 290 300
GQIPHPLGWL VPQQGQPVYP ITTGGFRHPY PTALTVNASM SRFPPHMVPP
310 320 330 340 350
HHTLHTTGIP HPAIVTPTVK QESSQSDVGS LHSSKHQDSK KEEEKKKPHI
360 370 380 390 400
KKPLNAFMLY MKEMRAKVVA ECTLKESAAI NQILGRRWHA LSREEQAKYY
410 420 430 440 450
ELARKERQLH MQLYPGWSAR DNYGKKKKRK RDKQPGETNE HSECFLNPCL
460 470 480 490 500
SLPPITDLSA PKKCRARFGL DQQNNWCGPC RRKKKCVRYI QGEGSCLSPP
510 520 530 540 550
SSDGSLLDSP PPSPNLLGSP PRDAKSQTEQ TQPLSLSLKP DPLAHLSMMP
560 570 580 590 600
PPPALLLAEA THKASALCPN GALDLPPAAL QPAAPSSSIA QPSTSSLHSH
610
SSLAGTQPQP LSLVTKSLE
Length:619
Mass (Da):67,919
Last modified:March 25, 2003 - v2
Checksum:i4DD2D3CC814AE16E
GO
Isoform 2 (identifier: Q9NQB0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA
     495-619: Missing.

Show »
Length:494
Mass (Da):55,152
Checksum:iAC0B8049DF6F4498
GO
Isoform 3 (identifier: Q9NQB0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Show »
Length:619
Mass (Da):67,976
Checksum:i6F0250E096854CC0
GO
Isoform 4 (identifier: Q9NQB0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.
     482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA
     495-619: Missing.

Show »
Length:477
Mass (Da):53,270
Checksum:i380199CA672A41A8
GO
Isoform 5 (identifier: Q9NQB0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.

Show »
Length:602
Mass (Da):66,037
Checksum:iA52CA392A33AB61C
GO
Isoform 6 (identifier: Q9NQB0-6) [UniParc]FASTAAdd to Basket

Also known as: TCF-4I

The sequence of this isoform differs from the canonical sequence as follows:
     457-619: DLSAPKKCRA...PLSLVTKSLE → GEKKSAFATYKVKAAASAHPLQMEAY

Show »
Length:482
Mass (Da):53,676
Checksum:iB68AD303BF9F3E25
GO
Isoform 7 (identifier: Q9NQB0-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Show »
Length:602
Mass (Da):66,094
Checksum:i87FC20BEB4F51BB2
GO
Isoform 8 (identifier: Q9NQB0-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.

Show »
Length:596
Mass (Da):65,291
Checksum:iA022284FEC164B09
GO
Isoform 9 (identifier: Q9NQB0-9) [UniParc]FASTAAdd to Basket

Also known as: TCF-4G

The sequence of this isoform differs from the canonical sequence as follows:
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:465
Mass (Da):51,794
Checksum:i5E1E47B5DCB132BE
GO
Isoform 10 (identifier: Q9NQB0-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     260-263: Missing.
     457-482: DLSAPKKCRARFGLDQQNNWCGPCRR → GEKKSAFATYKVKAAASAHPLQMEAY
     483-619: Missing.

Show »
Length:455
Mass (Da):50,611
Checksum:i2775B43A2E392581
GO
Isoform 11 (identifier: Q9NQB0-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     184-184: V → VSPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCIE
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:489
Mass (Da):54,572
Checksum:i9817D6DB995CBCD2
GO
Isoform 12 (identifier: Q9NQB0-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     481-619: RRKKKCVRYI...PLSLVTKSLE → SL

Note: Low expression in pancreas and colon.

Show »
Length:459
Mass (Da):51,159
Checksum:i59C37C6D178BD813
GO
Isoform 13 (identifier: Q9NQB0-13) [UniParc]FASTAAdd to Basket

Also known as: TCF-4J

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     440-456: Missing.
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Note: Common splicing form, lowest expression in skeletal muscle.

Show »
Length:579
Mass (Da):63,466
Checksum:iB2DEA916F03B0F63
GO
Isoform 14 (identifier: Q9NQB0-14) [UniParc]FASTAAdd to Basket

Also known as: TCF-4B, short

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Note: High transcriptional activity. Major isoform in liver.

Show »
Length:442
Mass (Da):49,166
Checksum:i57D7E679A87FF4C3
GO
Isoform 15 (identifier: Q9NQB0-15) [UniParc]FASTAAdd to Basket

Also known as: TCF-4A

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     290-290: M → MSSFLS
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:447
Mass (Da):49,688
Checksum:i1363601E57F2AA39
GO
Isoform 16 (identifier: Q9NQB0-16) [UniParc]FASTAAdd to Basket

Also known as: TCF-4K

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     290-290: M → MSSFLS
     440-456: Missing.

Show »
Length:584
Mass (Da):63,930
Checksum:i7AA2B6E62420108B
GO
Isoform 17 (identifier: Q9NQB0-17) [UniParc]FASTAAdd to Basket

Also known as: TCF-4X2

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MPQLNG → MSSFLS
     7-290: Missing.

Show »
Length:335
Mass (Da):36,884
Checksum:i6085EDAAE3D893A5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti118 – 1214NGSL → KRSV in CAB97212. (PubMed:10919662)Curated
Sequence conflicti118 – 1214NGSL → KRSV in CAB97213. (PubMed:10919662)Curated
Sequence conflicti167 – 1671Q → R in ADK35180. (PubMed:21256126)Curated
Sequence conflicti226 – 2261P → L in ADK35180. (PubMed:21256126)Curated
Sequence conflicti290 – 2901M → V in CAA72166. (PubMed:9065401)Curated
Sequence conflicti331 – 3311L → H in ACI28527. (PubMed:19602480)Curated
Sequence conflicti596 – 5961S → W in CAA72166. (PubMed:9065401)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti346 – 3461K → N.1 Publication
Corresponds to variant rs2757884 [ dbSNP | Ensembl ].
VAR_047126
Natural varianti465 – 4651R → C in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035939

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 66MPQLNG → MSSFLS in isoform 17. 1 PublicationVSP_053748
Alternative sequencei7 – 290284Missing in isoform 17. 1 PublicationVSP_053749Add
BLAST
Alternative sequencei128 – 15023Missing in isoform 8, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14, isoform 15 and isoform 16. 5 PublicationsVSP_006962Add
BLAST
Alternative sequencei184 – 1841V → VSPLPCCTQGHDCQHFYPPS DFTVSTQVFRDMKRSHSLQK VGEPWCIE in isoform 11. CuratedVSP_045821
Alternative sequencei260 – 2634Missing in isoform 10. 1 PublicationVSP_006963
Alternative sequencei290 – 2901M → MSSFLS in isoform 15 and isoform 16. 1 PublicationVSP_053750
Alternative sequencei440 – 46526EHSEC…PKKCR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 9, isoform 11, isoform 14 and isoform 15. 5 PublicationsVSP_006965Add
BLAST
Alternative sequencei440 – 45617Missing in isoform 4, isoform 5, isoform 7, isoform 13 and isoform 16. 2 PublicationsVSP_006964Add
BLAST
Alternative sequencei457 – 619163DLSAP…TKSLE → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 6. 1 PublicationVSP_006967Add
BLAST
Alternative sequencei457 – 48226DLSAP…GPCRR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 10. 1 PublicationVSP_006968Add
BLAST
Alternative sequencei457 – 47822DLSAP…NNWCG → DANTPKKCRALFGLDRQTLW CK in isoform 3, isoform 7 and isoform 13. 2 PublicationsVSP_006966Add
BLAST
Alternative sequencei466 – 619154Missing in isoform 9, isoform 11, isoform 14 and isoform 15. 5 PublicationsVSP_006969Add
BLAST
Alternative sequencei481 – 619139RRKKK…TKSLE → SL in isoform 12. 1 PublicationVSP_045822Add
BLAST
Alternative sequencei482 – 49413RKKKC…IQGEG → CKYSKEVSGTVRA in isoform 2 and isoform 4. CuratedVSP_006970Add
BLAST
Alternative sequencei483 – 619137Missing in isoform 10. 1 PublicationVSP_006971Add
BLAST
Alternative sequencei495 – 619125Missing in isoform 2 and isoform 4. CuratedVSP_006972Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y11306 mRNA. Translation: CAA72166.2.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270776, AJ270778 Genomic DNA. Translation: CAB97212.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270776, AJ270778 Genomic DNA. Translation: CAB97213.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270777, AJ270778 Genomic DNA. Translation: CAB97214.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270777, AJ270778 Genomic DNA. Translation: CAB97215.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270778 Genomic DNA. Translation: CAB97216.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270778 Genomic DNA. Translation: CAB97217.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270776, AJ270777 Genomic DNA. Translation: CAB97218.1.
AJ270770
, AJ270771, AJ270772, AJ270773, AJ270774, AJ270775, AJ270776, AJ270777 Genomic DNA. Translation: CAB97219.1.
FJ010167 mRNA. Translation: ACI28525.1.
FJ010169 mRNA. Translation: ACI28527.1.
FJ010172 mRNA. Translation: ACI28530.1.
HM352839 mRNA. Translation: ADK35175.1.
HM352842 mRNA. Translation: ADK35178.1.
HM352844 mRNA. Translation: ADK35180.1.
HM352845 mRNA. Translation: ADK35187.1.
HM352846 mRNA. Translation: ADK35181.1.
HM352847 mRNA. Translation: ADK35182.1.
HM352849 mRNA. Translation: ADK35184.1.
HM352850 mRNA. Translation: ADK35185.1.
AB440195 mRNA. Translation: BAH24004.1.
AK299295 mRNA. Translation: BAG61310.1.
AL135792 Genomic DNA. No translation available.
AL158212 Genomic DNA. No translation available.
AL445486 Genomic DNA. No translation available.
AL451084 Genomic DNA. No translation available.
CH471066 Genomic DNA. Translation: EAW49513.1.
CH471066 Genomic DNA. Translation: EAW49515.1.
CH471066 Genomic DNA. Translation: EAW49516.1.
BC032656 mRNA. Translation: AAH32656.1.
AB034691 mRNA. Translation: BAA86225.1.
CCDSiCCDS53578.1. [Q9NQB0-11]
CCDS55729.1. [Q9NQB0-12]
CCDS7576.1. [Q9NQB0-8]
PIRiS22807.
RefSeqiNP_001139746.1. NM_001146274.1. [Q9NQB0-7]
NP_001139755.1. NM_001146283.1. [Q9NQB0-11]
NP_001139756.1. NM_001146284.1. [Q9NQB0-10]
NP_001139758.1. NM_001146286.1. [Q9NQB0-14]
NP_001185455.1. NM_001198526.1. [Q9NQB0-13]
NP_001185457.1. NM_001198528.1. [Q9NQB0-12]
NP_001185460.1. NM_001198531.1. [Q9NQB0-9]
XP_005270141.1. XM_005270084.1. [Q9NQB0-1]
XP_005270146.1. XM_005270089.1.
XP_005270153.1. XM_005270096.1. [Q9NQB0-6]
XP_005270160.1. XM_005270103.1. [Q9NQB0-15]
UniGeneiHs.593995.

Genome annotation databases

EnsembliENST00000352065; ENSP00000344823; ENSG00000148737. [Q9NQB0-12]
ENST00000355717; ENSP00000347949; ENSG00000148737. [Q9NQB0-11]
ENST00000355995; ENSP00000348274; ENSG00000148737. [Q9NQB0-1]
ENST00000369397; ENSP00000358404; ENSG00000148737. [Q9NQB0-8]
ENST00000538897; ENSP00000446172; ENSG00000148737. [Q9NQB0-6]
GeneIDi6934.
KEGGihsa:6934.
UCSCiuc001lad.4. human. [Q9NQB0-10]
uc001lae.4. human. [Q9NQB0-7]
uc010qro.2. human.
uc021pyg.1. human.
uc021pyi.1. human. [Q9NQB0-1]
uc021pyj.1. human. [Q9NQB0-6]
uc021pyl.1. human.

Polymorphism databases

DMDMi29337146.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y11306 mRNA. Translation: CAA72166.2 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270776 , AJ270778 Genomic DNA. Translation: CAB97212.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270776 , AJ270778 Genomic DNA. Translation: CAB97213.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270777 , AJ270778 Genomic DNA. Translation: CAB97214.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270777 , AJ270778 Genomic DNA. Translation: CAB97215.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270778 Genomic DNA. Translation: CAB97216.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270778 Genomic DNA. Translation: CAB97217.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270776 , AJ270777 Genomic DNA. Translation: CAB97218.1 .
AJ270770
, AJ270771 , AJ270772 , AJ270773 , AJ270774 , AJ270775 , AJ270776 , AJ270777 Genomic DNA. Translation: CAB97219.1 .
FJ010167 mRNA. Translation: ACI28525.1 .
FJ010169 mRNA. Translation: ACI28527.1 .
FJ010172 mRNA. Translation: ACI28530.1 .
HM352839 mRNA. Translation: ADK35175.1 .
HM352842 mRNA. Translation: ADK35178.1 .
HM352844 mRNA. Translation: ADK35180.1 .
HM352845 mRNA. Translation: ADK35187.1 .
HM352846 mRNA. Translation: ADK35181.1 .
HM352847 mRNA. Translation: ADK35182.1 .
HM352849 mRNA. Translation: ADK35184.1 .
HM352850 mRNA. Translation: ADK35185.1 .
AB440195 mRNA. Translation: BAH24004.1 .
AK299295 mRNA. Translation: BAG61310.1 .
AL135792 Genomic DNA. No translation available.
AL158212 Genomic DNA. No translation available.
AL445486 Genomic DNA. No translation available.
AL451084 Genomic DNA. No translation available.
CH471066 Genomic DNA. Translation: EAW49513.1 .
CH471066 Genomic DNA. Translation: EAW49515.1 .
CH471066 Genomic DNA. Translation: EAW49516.1 .
BC032656 mRNA. Translation: AAH32656.1 .
AB034691 mRNA. Translation: BAA86225.1 .
CCDSi CCDS53578.1. [Q9NQB0-11 ]
CCDS55729.1. [Q9NQB0-12 ]
CCDS7576.1. [Q9NQB0-8 ]
PIRi S22807.
RefSeqi NP_001139746.1. NM_001146274.1. [Q9NQB0-7 ]
NP_001139755.1. NM_001146283.1. [Q9NQB0-11 ]
NP_001139756.1. NM_001146284.1. [Q9NQB0-10 ]
NP_001139758.1. NM_001146286.1. [Q9NQB0-14 ]
NP_001185455.1. NM_001198526.1. [Q9NQB0-13 ]
NP_001185457.1. NM_001198528.1. [Q9NQB0-12 ]
NP_001185460.1. NM_001198531.1. [Q9NQB0-9 ]
XP_005270141.1. XM_005270084.1. [Q9NQB0-1 ]
XP_005270146.1. XM_005270089.1.
XP_005270153.1. XM_005270096.1. [Q9NQB0-6 ]
XP_005270160.1. XM_005270103.1. [Q9NQB0-15 ]
UniGenei Hs.593995.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1JDH X-ray 1.90 B 12-49 [» ]
1JPW X-ray 2.50 D/E/F 6-54 [» ]
2GL7 X-ray 2.60 B/E 1-53 [» ]
DisProti DP00175.
ProteinModelPortali Q9NQB0.
SMRi Q9NQB0. Positions 12-49, 349-424.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112795. 22 interactions.
DIPi DIP-36236N.
IntActi Q9NQB0. 32 interactions.
MINTi MINT-222146.

Chemistry

ChEMBLi CHEMBL3038511.

PTM databases

PhosphoSitei Q9NQB0.

Polymorphism databases

DMDMi 29337146.

Proteomic databases

MaxQBi Q9NQB0.
PaxDbi Q9NQB0.
PRIDEi Q9NQB0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000352065 ; ENSP00000344823 ; ENSG00000148737 . [Q9NQB0-12 ]
ENST00000355717 ; ENSP00000347949 ; ENSG00000148737 . [Q9NQB0-11 ]
ENST00000355995 ; ENSP00000348274 ; ENSG00000148737 . [Q9NQB0-1 ]
ENST00000369397 ; ENSP00000358404 ; ENSG00000148737 . [Q9NQB0-8 ]
ENST00000538897 ; ENSP00000446172 ; ENSG00000148737 . [Q9NQB0-6 ]
GeneIDi 6934.
KEGGi hsa:6934.
UCSCi uc001lad.4. human. [Q9NQB0-10 ]
uc001lae.4. human. [Q9NQB0-7 ]
uc010qro.2. human.
uc021pyg.1. human.
uc021pyi.1. human. [Q9NQB0-1 ]
uc021pyj.1. human. [Q9NQB0-6 ]
uc021pyl.1. human.

Organism-specific databases

CTDi 6934.
GeneCardsi GC10P114710.
HGNCi HGNC:11641. TCF7L2.
HPAi CAB013535.
HPA038800.
MIMi 125853. phenotype.
602228. gene.
neXtProti NX_Q9NQB0.
PharmGKBi PA36394.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG252916.
GeneTreei ENSGT00390000009964.
HOVERGENi HBG000419.
InParanoidi Q9NQB0.
KOi K04491.
OMAi EPWCLES.
OrthoDBi EOG7QNVMG.
PhylomeDBi Q9NQB0.
TreeFami TF318448.

Enzyme and pathway databases

Reactomei REACT_172761. Ca2+ pathway.
REACT_200731. deactivation of the beta-catenin transactivating complex.
REACT_200753. formation of the beta-catenin:TCF transactivating complex.
REACT_200799. binding of TCF/LEF:CTNNB1 to target gene promoters.
REACT_24019. Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1).
SignaLinki Q9NQB0.

Miscellaneous databases

ChiTaRSi TCF7L2. human.
EvolutionaryTracei Q9NQB0.
GeneWikii TCF7L2.
GenomeRNAii 6934.
NextBioi 27133.
PROi Q9NQB0.
SOURCEi Search...

Gene expression databases

Bgeei Q9NQB0.
CleanExi HS_TCF4.
ExpressionAtlasi Q9NQB0. baseline and differential.
Genevestigatori Q9NQB0.

Family and domain databases

Gene3Di 1.10.30.10. 1 hit.
4.10.900.10. 1 hit.
InterProi IPR027397. Catenin_binding_dom.
IPR013558. CTNNB1-bd_N.
IPR009071. HMG_box_dom.
IPR024940. TCF/LEF.
IPR028773. TCF7L2.
[Graphical view ]
PANTHERi PTHR10373. PTHR10373. 1 hit.
PTHR10373:SF32. PTHR10373:SF32. 1 hit.
Pfami PF08347. CTNNB1_binding. 1 hit.
PF00505. HMG_box. 1 hit.
[Graphical view ]
SMARTi SM00398. HMG. 1 hit.
[Graphical view ]
SUPFAMi SSF47095. SSF47095. 1 hit.
PROSITEi PS50118. HMG_BOX_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC-/- colon carcinoma."
    Korinek V., Barker N., Morin P.J., van Wichen D., de Weger R., Kinzler K.W., Vogelstein B., Clevers H.
    Science 275:1784-1787(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 8 AND 9), INTERACTION WITH CTNNB1.
    Tissue: Fetus.
  2. "The human T cell transcription factor-4 gene: structure, extensive characterization of alternative splicings, and mutational analysis in colorectal cancer cell lines."
    Duval A., Rolland S., Tubacher E., Bui H., Thomas G., Hamelin R.
    Cancer Res. 60:3872-3879(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 9), VARIANT ASN-346.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 12; 13 AND 14), ALTERNATIVE SPLICING.
    Tissue: Brain.
  4. "Identification of T-cell factor-4 isoforms that contribute to the malignant phenotype of hepatocellular carcinoma cells."
    Tsedensodnom O., Koga H., Rosenberg S.A., Nambotin S.B., Carroll J.J., Wands J.R., Kim M.
    Exp. Cell Res. 317:920-931(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6; 9; 13; 14; 15 AND 17), ALTERNATIVE SPLICING.
  5. "ALEX1, a putative tumor suppressor, is regulated by CREB-dependent Wnt signaling, and is silenced by promoter methylation in human colorectal cancer."
    Iseki H., Takeda A., Andou T., Takahashi N., Ban S., Kurochkin I.V., Okazaki Y., Koyama I.
    Submitted (JUN-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 9).
    Tissue: Colon.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 14).
  7. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
    Tissue: Uterus.
  10. "Human TCF-4 splice form B."
    Saeki H., Tanaka S., Sugimachi K.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 449-494.
    Tissue: Gastric carcinoma.
  11. Cited for: FUNCTION.
  12. "Restricted high level expression of Tcf-4 protein in intestinal and mammary gland epithelium."
    Barker N., Huls G., Korinek V., Clevers H.
    Am. J. Pathol. 154:29-35(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INTERACTION WITH CTNNB1, SUBCELLULAR LOCATION.
  13. "Identification of Tcf4 residues involved in high-affinity beta-catenin binding."
    Omer C.A., Miller P.J., Diehl R.E., Kral A.M.
    Biochem. Biophys. Res. Commun. 256:584-590(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CTNNB1, MUTAGENESIS OF 10-ASP-ASP-11; ASP-16; GLU-17; 23-ASP-GLU-24 AND LEU-48.
  14. "All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
    Brantjes H., Roose J., van De Wetering M., Clevers H.
    Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TLE1; TLE2; TLE3 AND TLE4.
  15. Cited for: FUNCTION.
  16. "Sumoylation is involved in beta-catenin-dependent activation of Tcf-4."
    Yamamoto H., Ihara M., Matsuura Y., Kikuchi A.
    EMBO J. 22:2047-2059(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION AT LYS-320, INTERACTION WITH PIAS4, FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-320 AND GLU-322.
  17. "Identification of a promoter-specific transcriptional activation domain at the C-terminus of the Wnt effector protein T-cell factor 4."
    Hecht A., Stemmler M.P.
    J. Biol. Chem. 278:3776-3785(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EP300.
  18. "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling."
    Ishitani T., Ninomiya-Tsuji J., Matsumoto K.
    Mol. Cell. Biol. 23:1379-1389(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NLK, PHOSPHORYLATION AT THR-201 AND/OR THR-212 BY NLK, MUTAGENESIS OF THR-201 AND THR-212.
  19. "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)."
    Yamada M., Ohnishi J., Ohkawara B., Iemura S., Satoh K., Hyodo-Miura J., Kawachi K., Natsume T., Shibuya H.
    J. Biol. Chem. 281:20749-20760(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NLK.
  20. Cited for: INVOLVEMENT IN NIDDM.
  21. "The C/EBP homologous protein CHOP (GADD153) is an inhibitor of Wnt/TCF signals."
    Horndasch M., Lienkamp S., Springer E., Schmitt A., Pavenstaedt H., Walz G., Gloy J.
    Oncogene 25:3397-3407(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DDIT3.
  22. "Coiled-coil domain containing 85B suppresses the beta-catenin activity in a p53-dependent manner."
    Iwai A., Hijikata M., Hishiki T., Isono O., Chiba T., Shimotohno K.
    Oncogene 27:1520-1526(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CCDC85B.
  23. "The kinase TNIK is an essential activator of Wnt target genes."
    Mahmoudi T., Li V.S.W., Ng S.S., Taouatas N., Vries R.G.J., Mohammed S., Heck A.J., Clevers H.
    EMBO J. 28:3329-3340(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TNIK AND CTNNB1.
  24. "MAD2B, a novel TCF4-binding protein, modulates TCF4-mediated epithelial-mesenchymal transdifferentiation."
    Hong C.F., Chou Y.T., Lin Y.S., Wu C.W.
    J. Biol. Chem. 284:19613-19622(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MAD2L2.
  25. "Zipper-interacting protein kinase (ZIPK) modulates canonical Wnt/beta-catenin signaling through interaction with Nemo-like kinase and T-cell factor 4 (NLK/TCF4)."
    Togi S., Ikeda O., Kamitani S., Nakasuji M., Sekine Y., Muromoto R., Nanbo A., Oritani K., Kawai T., Akira S., Matsuda T.
    J. Biol. Chem. 286:19170-19177(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NLK AND ZIPK/DAPK3.
  26. "Kindlin 2 forms a transcriptional complex with beta-catenin and TCF4 to enhance Wnt signalling."
    Yu Y., Wu J., Wang Y., Zhao T., Ma B., Liu Y., Fang W., Zhu W.G., Zhang H.
    EMBO Rep. 13:750-758(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, IDENTIFICATION IN A COMPLEX WITH FERMT2 AND CTNNB1, SUBCELLULAR LOCATION.
  27. "Beta-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells."
    Satow R., Shitashige M., Jigami T., Fukami K., Honda K., Kitabayashi I., Yamada T.
    Gastroenterology 142:572-581(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PML.
  28. "SPINDLIN1 promotes cancer cell proliferation through activation of WNT/TCF-4 signaling."
    Wang J.X., Zeng Q., Chen L., Du J.C., Yan X.L., Yuan H.F., Zhai C., Zhou J.N., Jia Y.L., Yue W., Pei X.T.
    Mol. Cancer Res. 10:326-335(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SPIN1.
  29. "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling."
    Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E.
    Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH XIAP/BIRC4 AND TLE3.
  30. "Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1."
    Su X., Zhu G., Ding X., Lee S.Y., Dou Y., Zhu B., Wu W., Li H.
    Genes Dev. 28:622-636(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SPIN1.
  31. "Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico."
    The SIGMA Type 2 Diabetes Consortium
    Nature 506:97-101(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN NIDDM.
  32. "Tcf4 can specifically recognize beta-catenin using alternative conformations."
    Graham T.A., Ferkey D.M., Mao F., Kimelman D., Xu W.
    Nat. Struct. Biol. 8:1048-1052(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 12-49 IN COMPLEX WITH THE ARMADILLO REPEAT REGION OF CTNNB1, MUTAGENESIS OF GLU-24; GLU-26; GLU-28 AND GLU-29.
  33. Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 8-54 IN COMPLEX WITH THE ARMADILLO REPEAT REGION OF CTNNB1, MUTAGENESIS OF ILE-19 AND PHE-21.
  34. "Crystal structure of a beta-catenin/BCL9/Tcf4 complex."
    Sampietro J., Dahlberg C.L., Cho U.S., Hinds T.R., Kimelman D., Xu W.
    Mol. Cell 24:293-300(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 1-53 IN COMPLEX WITH BCL9 AND CTNNB1, INTERACTION WITH CTNNB1.
  35. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-465.

Entry informationi

Entry nameiTF7L2_HUMAN
AccessioniPrimary (citable) accession number: Q9NQB0
Secondary accession number(s): B4DRJ8
, B9X074, C6ZRJ8, C6ZRK0, E2GH14, E2GH19, E2GH20, E2GH24, E2GH25, E9PFH9, F8W742, F8W7T5, O00185, Q9NQB1, Q9NQB2, Q9NQB3, Q9NQB4, Q9NQB5, Q9NQB6, Q9NQB7, Q9ULC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 25, 2003
Last modified: October 29, 2014
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3