Q9NQB0 (TF7L2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor 7-like 2 Alternative name(s): HMG box transcription factor 4 T-cell-specific transcription factor 4 Short name=T-cell factor 4 Short name=TCF-4 Short name=hTCF-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 619 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. Ref.6 Ref.10 Ref.11 Ref.18 |
| Subunit structure | Interacts with TGFB1I1 By similarity. Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex. Interacts with EP300. Interacts with NLK. Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1. Interacts with TNIK. Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity. Interacts with ZIPK/DAPK3. Interacts with XIAP/BIRC4 and TLE3. Interacts with DDIT3/CHOP. Ref.1 Ref.7 Ref.8 Ref.9 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 |
| Subcellular location | Nucleus › PML body. Note: Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies. Ref.7 Ref.11 |
| Tissue specificity | Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom. Ref.7 |
| Developmental stage | Highly expressed in crypt regions and barely detectable in villi in epithelium from fetal small intestine at week 16. At week 22 expression in villi had increased strongly. |
| Domain | The promoter-specific activation domain interacts with the transcriptional coactivator EP300. |
| Post-translational modification | In vitro, phosphorylated by TNIK. Ref.13 Phosphorylated at Thr-201 and/or Thr-212 by NLK. Phosphorylation by NLK at these sites inhibits DNA-binding by TCF7L2/TCF4, thereby preventing transcriptional activation of target genes of the canonical Wnt/beta-catenin signaling pathway. Ref.13 Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylation is enhanced by SENP2. Sumoylation/desumoylation regulates TCF7L2/TCF4 transcription activity in the Wnt/beta-catenin signaling pathway without altering interaction with CTNNB1 nor binding to DNA. Ref.11 |
| Involvement in disease | Constitutive activation and subsequent transactivation of target genes may lead to the maintenance of stem-cell characteristics (cycling and longevity) in cells that should normally undergo terminal differentiation and constitute the primary transforming event in colorectal cancer (CRC). Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. |
| Sequence similarities | Belongs to the TCF/LEF family. Contains 1 HMG box DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CTNNB1 | P35222 | 27 | EBI-924724,EBI-491549 | |
| DAXX | Q9UER7 | 5 | EBI-924724,EBI-77321 | |
| JUP | P14923 | 13 | EBI-924724,EBI-702484 | |
| RUNX3 | Q13761 | 14 | EBI-924724,EBI-925990 | |
| XRCC6 | P12956 | 9 | EBI-924724,EBI-353208 |
Alternative products
| This entry describes 12 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NQB0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NQB0-2) The sequence of this isoform differs from the canonical sequence as follows: 482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA 495-619: Missing. | ||||||
| Isoform 3 (identifier: Q9NQB0-3) The sequence of this isoform differs from the canonical sequence as follows: 457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK | ||||||
| Isoform 4 (identifier: Q9NQB0-4) The sequence of this isoform differs from the canonical sequence as follows: 440-456: Missing. 482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA 495-619: Missing. | ||||||
| Isoform 5 (identifier: Q9NQB0-5) The sequence of this isoform differs from the canonical sequence as follows: 440-456: Missing. | ||||||
| Isoform 6 (identifier: Q9NQB0-6) The sequence of this isoform differs from the canonical sequence as follows: 457-619: DLSAPKKCRA...PLSLVTKSLE → GEKKSAFATYKVKAAASAHPLQMEAY | ||||||
| Isoform 7 (identifier: Q9NQB0-7) The sequence of this isoform differs from the canonical sequence as follows: 440-456: Missing. 457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK | ||||||
| Isoform 8 (identifier: Q9NQB0-8) The sequence of this isoform differs from the canonical sequence as follows: 128-150: Missing. | ||||||
| Isoform 9 (identifier: Q9NQB0-9) The sequence of this isoform differs from the canonical sequence as follows: 440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY 466-619: Missing. | ||||||
| Isoform 10 (identifier: Q9NQB0-10) The sequence of this isoform differs from the canonical sequence as follows: 128-150: Missing. 260-263: Missing. 457-482: DLSAPKKCRARFGLDQQNNWCGPCRR → GEKKSAFATYKVKAAASAHPLQMEAY 483-619: Missing. | ||||||
| Isoform 11 (identifier: Q9NQB0-11) The sequence of this isoform differs from the canonical sequence as follows: 128-150: Missing. 184-184: V → VSPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCIE 440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY 466-619: Missing. | ||||||
| Isoform 12 (identifier: Q9NQB0-12) The sequence of this isoform differs from the canonical sequence as follows: 128-150: Missing. 481-619: RRKKKCVRYI...PLSLVTKSLE → SL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 619 | 619 | Transcription factor 7-like 2 | PRO_0000048623 | |||||||||
Regions | |||||||||||||
| DNA binding | 350 – 418 | 69 | HMG box | ||||||||||
| Region | 1 – 53 | 53 | CTNNB1-binding By similarity | ||||||||||
| Region | 201 – 395 | 195 | Mediates interaction with MAD2L2 | ||||||||||
| Region | 459 – 505 | 47 | Promoter-specific activation domain | ||||||||||
| Motif | 425 – 430 | 6 | Nuclear localization signal Potential | ||||||||||
| Compositional bias | 178 – 317 | 140 | Pro-rich | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 201 | 1 | Phosphothreonine; by NLK Probable | ||||||||||
| Modified residue | 212 | 1 | Phosphothreonine; by NLK Probable | ||||||||||
| Cross-link | 320 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.11 | |||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 128 – 150 | 23 | Missing in isoform 8, isoform 10, isoform 11 and isoform 12. | VSP_006962 | |||||||||
| Alternative sequence | 184 | 1 | V → VSPLPCCTQGHDCQHFYPPS DFTVSTQVFRDMKRSHSLQK VGEPWCIE in isoform 11. | VSP_045821 | |||||||||
| Alternative sequence | 260 – 263 | 4 | Missing in isoform 10. | VSP_006963 | |||||||||
| Alternative sequence | 440 – 465 | 26 | EHSEC…PKKCR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 9 and isoform 11. | VSP_006965 | |||||||||
| Alternative sequence | 440 – 456 | 17 | Missing in isoform 4, isoform 5 and isoform 7. | VSP_006964 | |||||||||
| Alternative sequence | 457 – 619 | 163 | DLSAP…TKSLE → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 6. | VSP_006967 | |||||||||
| Alternative sequence | 457 – 482 | 26 | DLSAP…GPCRR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 10. | VSP_006968 | |||||||||
| Alternative sequence | 457 – 478 | 22 | DLSAP…NNWCG → DANTPKKCRALFGLDRQTLW CK in isoform 3 and isoform 7. | VSP_006966 | |||||||||
| Alternative sequence | 466 – 619 | 154 | Missing in isoform 9 and isoform 11. | VSP_006969 | |||||||||
| Alternative sequence | 481 – 619 | 139 | RRKKK…TKSLE → SL in isoform 12. | VSP_045822 | |||||||||
| Alternative sequence | 482 – 494 | 13 | RKKKC…IQGEG → CKYSKEVSGTVRA in isoform 2 and isoform 4. | VSP_006970 | |||||||||
| Alternative sequence | 483 – 619 | 137 | Missing in isoform 10. | VSP_006971 | |||||||||
| Alternative sequence | 495 – 619 | 125 | Missing in isoform 2 and isoform 4. | VSP_006972 | |||||||||
| Natural variant | 346 | 1 | K → N. Ref.2 Corresponds to variant rs2757884 [ dbSNP | Ensembl ]. | VAR_047126 | |||||||||
| Natural variant | 465 | 1 | R → C in a colorectal cancer sample; somatic mutation. Ref.24 | VAR_035939 | |||||||||
Experimental info | |||||||||||||
| Mutagenesis | 10 – 11 | 2 | DD → AA: Reduces CTNNB1 binding. | ||||||||||
| Mutagenesis | 16 | 1 | D → A: Abolishes CTNNB1 binding. Ref.8 | ||||||||||
| Mutagenesis | 17 | 1 | E → A: Reduces CTNNB1 binding. Ref.8 | ||||||||||
| Mutagenesis | 19 | 1 | I → A: Reduces transcription activation. Ref.22 | ||||||||||
| Mutagenesis | 21 | 1 | F → A: Reduces transcription activation. Ref.22 | ||||||||||
| Mutagenesis | 23 – 24 | 2 | DE → AA: Reduces CTNNB1 binding. Ref.21 | ||||||||||
| Mutagenesis | 24 | 1 | E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-26; A-28 and A-29. Ref.21 | ||||||||||
| Mutagenesis | 26 | 1 | E → A: Abolishes CTNNB1 binding; when associated with A-24; A-28 and A-29. Ref.21 | ||||||||||
| Mutagenesis | 28 | 1 | E → A: Abolishes CTNNB1 binding; when associated with A-24; A-26 and A-29. Ref.21 | ||||||||||
| Mutagenesis | 29 | 1 | E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-24; A-26 and A-28. Ref.21 | ||||||||||
| Mutagenesis | 48 | 1 | L → A: Abolishes CTNNB1 binding. Ref.8 | ||||||||||
| Mutagenesis | 201 | 1 | T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-212. Ref.13 | ||||||||||
| Mutagenesis | 212 | 1 | T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-201. Ref.13 | ||||||||||
| Mutagenesis | 320 | 1 | K → R: Loss of sumoylation. No effect on localization to nuclear bodies. Ref.11 | ||||||||||
| Mutagenesis | 322 | 1 | E → A: Loss of sumoylation. Ref.11 | ||||||||||
| Sequence conflict | 118 – 121 | 4 | NGSL → KRSV in CAB97212. Ref.2 | ||||||||||
| Sequence conflict | 118 – 121 | 4 | NGSL → KRSV in CAB97213. Ref.2 | ||||||||||
| Sequence conflict | 290 | 1 | M → V in CAA72166. Ref.1 | ||||||||||
| Sequence conflict | 596 | 1 | S → W in CAA72166. Ref.1 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 22 – 31 | 10 | |||||||||||
| Helix | 38 – 48 | 11 | |||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC-/- colon carcinoma." Korinek V., Barker N., Morin P.J., van Wichen D., de Weger R., Kinzler K.W., Vogelstein B., Clevers H. Science 275:1784-1787(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 8 AND 9), INTERACTION WITH CTNNB1. Tissue: Fetus. |
| [2] | "The human T cell transcription factor-4 gene: structure, extensive characterization of alternative splicings, and mutational analysis in colorectal cancer cell lines." Duval A., Rolland S., Tubacher E., Bui H., Thomas G., Hamelin R. Cancer Res. 60:3872-3879(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 9), VARIANT ASN-346. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10). Tissue: Uterus. |
| [5] | "Human TCF-4 splice form B." Saeki H., Tanaka S., Sugimachi K. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 449-494. Tissue: Gastric carcinoma. |
| [6] | "Identification of c-MYC as a target of the APC pathway." He T.-C., Sparks A.B., Rago C., Hermeking H., Zawel L., da Costa L.T., Morin P.J., Vogelstein B., Kinzler K.W. Science 281:1509-1512(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Restricted high level expression of Tcf-4 protein in intestinal and mammary gland epithelium." Barker N., Huls G., Korinek V., Clevers H. Am. J. Pathol. 154:29-35(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH CTNNB1, SUBCELLULAR LOCATION. |
| [8] | "Identification of Tcf4 residues involved in high-affinity beta-catenin binding." Omer C.A., Miller P.J., Diehl R.E., Kral A.M. Biochem. Biophys. Res. Commun. 256:584-590(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1, MUTAGENESIS OF 10-ASP-ASP-11; ASP-16; GLU-17; 23-ASP-GLU-24 AND LEU-48. |
| [9] | "All Tcf HMG box transcription factors interact with Groucho-related co-repressors." Brantjes H., Roose J., van De Wetering M., Clevers H. Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TLE1; TLE2; TLE3 AND TLE4. |
| [10] | "The beta-catenin/TCF-4 complex imposes a crypt progenitor phenotype on colorectal cancer cells." van de Wetering M., Sancho E., Verweij C., de Lau W., Oving I., Hurlstone A., van der Horn K., Batlle E., Coudreuse D., Haramis A.-P., Tjon-Pon-Fong M., Moerer P., van den Born M., Soete G., Pals S., Eilers M., Medema R., Clevers H. Cell 111:241-250(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Sumoylation is involved in beta-catenin-dependent activation of Tcf-4." Yamamoto H., Ihara M., Matsuura Y., Kikuchi A. EMBO J. 22:2047-2059(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-320, INTERACTION WITH PIAS4, FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-320 AND GLU-322. |
| [12] | "Identification of a promoter-specific transcriptional activation domain at the C-terminus of the Wnt effector protein T-cell factor 4." Hecht A., Stemmler M.P. J. Biol. Chem. 278:3776-3785(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EP300. |
| [13] | "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling." Ishitani T., Ninomiya-Tsuji J., Matsumoto K. Mol. Cell. Biol. 23:1379-1389(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLK, PHOSPHORYLATION AT THR-201 AND/OR THR-212 BY NLK, MUTAGENESIS OF THR-201 AND THR-212. |
| [14] | "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)." Yamada M., Ohnishi J., Ohkawara B., Iemura S., Satoh K., Hyodo-Miura J., Kawachi K., Natsume T., Shibuya H. J. Biol. Chem. 281:20749-20760(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLK. |
| [15] | "The C/EBP homologous protein CHOP (GADD153) is an inhibitor of Wnt/TCF signals." Horndasch M., Lienkamp S., Springer E., Schmitt A., Pavenstaedt H., Walz G., Gloy J. Oncogene 25:3397-3407(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DDIT3. |
| [16] | "Coiled-coil domain containing 85B suppresses the beta-catenin activity in a p53-dependent manner." Iwai A., Hijikata M., Hishiki T., Isono O., Chiba T., Shimotohno K. Oncogene 27:1520-1526(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CCDC85B. |
| [17] | "The kinase TNIK is an essential activator of Wnt target genes." Mahmoudi T., Li V.S.W., Ng S.S., Taouatas N., Vries R.G.J., Mohammed S., Heck A.J., Clevers H. EMBO J. 28:3329-3340(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TNIK AND CTNNB1. |
| [18] | "MAD2B, a novel TCF4-binding protein, modulates TCF4-mediated epithelial-mesenchymal transdifferentiation." Hong C.F., Chou Y.T., Lin Y.S., Wu C.W. J. Biol. Chem. 284:19613-19622(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAD2L2. |
| [19] | "Zipper-interacting protein kinase (ZIPK) modulates canonical Wnt/beta-catenin signaling through interaction with Nemo-like kinase and T-cell factor 4 (NLK/TCF4)." Togi S., Ikeda O., Kamitani S., Nakasuji M., Sekine Y., Muromoto R., Nanbo A., Oritani K., Kawai T., Akira S., Matsuda T. J. Biol. Chem. 286:19170-19177(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLK AND ZIPK/DAPK3. |
| [20] | "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling." Hanson A.J., Wallace H.A., Freeman T.J., Beauchamp R.D., Lee L.A., Lee E. Mol. Cell 45:619-628(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH XIAP/BIRC4 AND TLE3. |
| [21] | "Tcf4 can specifically recognize beta-catenin using alternative conformations." Graham T.A., Ferkey D.M., Mao F., Kimelman D., Xu W. Nat. Struct. Biol. 8:1048-1052(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 12-49 IN COMPLEX WITH THE ARMADILLO REPEAT REGION OF CTNNB1, MUTAGENESIS OF GLU-24; GLU-26; GLU-28 AND GLU-29. |
| [22] | "Structure of a human Tcf4-beta-catenin complex." Poy F., Lepourcelet M., Shivdasani R.A., Eck M.J. Nat. Struct. Biol. 8:1053-1057(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 8-54 IN COMPLEX WITH THE ARMADILLO REPEAT REGION OF CTNNB1, MUTAGENESIS OF ILE-19 AND PHE-21. |
| [23] | "Variant of transcription factor 7-like 2 (TCF7L2) gene confers risk of type 2 diabetes." Grant S.F.A., Thorleifsson G., Reynisdottir I., Benediktsson R., Manolescu A., Sainz J., Helgason A., Stefansson H., Emilsson V., Helgadottir A., Styrkarsdottir U., Magnusson K.P., Walters G.B., Palsdottir E., Jonsdottir T., Gudmundsdottir T., Gylfason A., Saemundsdottir J. Stefansson K.Nat. Genet. 38:320-323(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN NIDDM. |
| [24] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-465. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y11306 mRNA. Translation: CAA72166.2. AJ270770 AJ270778 Genomic DNA. Translation: CAB97212.1.AJ270770 AJ270778 Genomic DNA. Translation: CAB97213.1.AJ270770 AJ270778 Genomic DNA. Translation: CAB97214.1.AJ270770 AJ270778 Genomic DNA. Translation: CAB97215.1.AJ270770 AJ270778 Genomic DNA. Translation: CAB97216.1.AJ270770 AJ270778 Genomic DNA. Translation: CAB97217.1.AJ270770 AJ270777 Genomic DNA. Translation: CAB97218.1.AJ270770 AJ270777 Genomic DNA. Translation: CAB97219.1.AL135792 Genomic DNA. No translation available. AL158212 Genomic DNA. No translation available. AL445486 Genomic DNA. No translation available. AL451084 Genomic DNA. No translation available. BC032656 mRNA. Translation: AAH32656.1. AB034691 mRNA. Translation: BAA86225.1. | ||||||||||||||||||||||||
| IPI | IPI00164708. IPI00221004. IPI00221005. IPI00221006. IPI00221007. IPI00221008. IPI00221009. IPI00221010. IPI00221011. IPI00335587. IPI00479483. IPI00983769. | ||||||||||||||||||||||||
| PIR | S22807. | ||||||||||||||||||||||||
| RefSeq | NP_001139746.1. NM_001146274.1. NP_001139755.1. NM_001146283.1. NP_001139756.1. NM_001146284.1. | ||||||||||||||||||||||||
| UniGene | Hs.593995. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| DisProt | DP00175. | ||||||||||||||||||||||||
| ProteinModelPortal | Q9NQB0. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-36236N. | ||||||||||||||||||||||||
| IntAct | Q9NQB0. 27 interactions. | ||||||||||||||||||||||||
| MINT | MINT-222146. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q9NQB0. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 29337146. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q9NQB0. | ||||||||||||||||||||||||
| PRIDE | Q9NQB0. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000352065; ENSP00000344823; ENSG00000148737. ENST00000355717; ENSP00000347949; ENSG00000148737. ENST00000355995; ENSP00000348274; ENSG00000148737. ENST00000369397; ENSP00000358404; ENSG00000148737. ENST00000534894; ENSP00000443626; ENSG00000148737. ENST00000536810; ENSP00000446238; ENSG00000148737. ENST00000538897; ENSP00000446172; ENSG00000148737. ENST00000543371; ENSP00000444972; ENSG00000148737. ENST00000545257; ENSP00000440547; ENSG00000148737. | ||||||||||||||||||||||||
| GeneID | 6934. | ||||||||||||||||||||||||
| KEGG | hsa:6934. | ||||||||||||||||||||||||
| UCSC | uc001lad.4. human. uc001lae.4. human. uc021pyi.1. human. uc021pyj.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 6934. | ||||||||||||||||||||||||
| GeneCards | GC10P114700. | ||||||||||||||||||||||||
| HGNC | HGNC:11641. TCF7L2. | ||||||||||||||||||||||||
| HPA | CAB013535. | ||||||||||||||||||||||||
| MIM | 125853. phenotype. 602228. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q9NQB0. | ||||||||||||||||||||||||
| PharmGKB | PA36394. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG252916. | ||||||||||||||||||||||||
| HOVERGEN | HBG000419. | ||||||||||||||||||||||||
| KO | K04491. | ||||||||||||||||||||||||
| OMA | EPWCLES. | ||||||||||||||||||||||||
| OrthoDB | EOG43XV3J. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9NQB0. | ||||||||||||||||||||||||
| Bgee | Q9NQB0. | ||||||||||||||||||||||||
| CleanEx | HS_TCF4. | ||||||||||||||||||||||||
| Genevestigator | Q9NQB0. | ||||||||||||||||||||||||
| GermOnline | ENSG00000148737. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.30.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR013558. CTNNB1-bd_N. IPR009071. HMG_box_dom. IPR024940. TCF/LEF. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR10373. PTHR10373. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF08347. CTNNB1_binding. 1 hit. PF00505. HMG_box. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00398. HMG. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47095. HMG-box. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50118. HMG_BOX_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChEMBL | CHEMBL1914264. | ||||||||||||||||||||||||
| ChiTaRS | TCF7L2. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q9NQB0. | ||||||||||||||||||||||||
| GenomeRNAi | 6934. | ||||||||||||||||||||||||
| NextBio | 27133. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | TF7L2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQB0 Secondary accession number(s): F8W742 Q9ULC2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
