Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

APOBEC1 complementation factor

Gene

A1CF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.3 Publications

GO - Molecular functioni

  • nucleotide binding Source: InterPro
  • RNA binding Source: ProtInc
  • single-stranded RNA binding Source: UniProtKB

GO - Biological processi

  • cytidine to uridine editing Source: Reactome
  • mRNA modification Source: InterPro
  • mRNA processing Source: UniProtKB-KW
  • protein stabilization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

mRNA processing

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-72200. mRNA Editing: C to U Conversion.
R-HSA-75094. Formation of the Editosome.

Names & Taxonomyi

Protein namesi
Recommended name:
APOBEC1 complementation factor
Alternative name(s):
APOBEC1-stimulating protein
Gene namesi
Name:A1CF
Synonyms:ACF, ASPImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:24086. A1CF.

Subcellular locationi

GO - Cellular componenti

  • apolipoprotein B mRNA editing enzyme complex Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • endoplasmic reticulum Source: UniProtKB-SubCell
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi59F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi100F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi139F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi183F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi234Y → A: Slightly reduced RNA binding. 1 Publication1
Mutagenesisi270F → A: Slightly reduced RNA binding. 1 Publication1

Organism-specific databases

DisGeNETi29974.
OpenTargetsiENSG00000148584.
PharmGKBiPA162375098.

Polymorphism and mutation databases

BioMutaiA1CF.
DMDMi74761651.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000814821 – 594APOBEC1 complementation factorAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei499PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NQ94.
PaxDbiQ9NQ94.
PeptideAtlasiQ9NQ94.
PRIDEiQ9NQ94.

PTM databases

iPTMnetiQ9NQ94.
PhosphoSitePlusiQ9NQ94.

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.1 Publication

Gene expression databases

BgeeiENSG00000148584.
CleanExiHS_A1CF.
ExpressionAtlasiQ9NQ94. baseline and differential.
GenevisibleiQ9NQ94. HS.

Organism-specific databases

HPAiHPA037779.
HPA044079.

Interactioni

Subunit structurei

Part of the apolipoprotein B mRNA editing complex with APOBEC1. Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus. Interacts with SYNCRIP. Interacts with CELF2/CUGBP2 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
FHL3Q136433EBI-2809489,EBI-741101
RELQ048643EBI-2809489,EBI-307352
SDPRO958103EBI-10311892,EBI-742141
TRAF1Q130775EBI-2809489,EBI-359224

Protein-protein interaction databases

BioGridi119004. 11 interactors.
IntActiQ9NQ94. 10 interactors.
STRINGi9606.ENSP00000282641.

Structurei

Secondary structure

1594
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi232 – 237Combined sources6
Helixi244 – 252Combined sources9
Beta strandi259 – 264Combined sources6
Beta strandi266 – 275Combined sources10
Helixi276 – 286Combined sources11
Beta strandi287 – 291Combined sources5
Beta strandi294 – 299Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CPDNMR-A223-308[»]
ProteinModelPortaliQ9NQ94.
SMRiQ9NQ94.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NQ94.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 134RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini136 – 218RRM 2PROSITE-ProRule annotationAdd BLAST83
Domaini231 – 303RRM 3PROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni360 – 409Required for nuclear localization1 PublicationAdd BLAST50

Domaini

The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity.1 Publication

Sequence similaritiesi

Contains 3 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0117. Eukaryota.
ENOG410XTJ5. LUCA.
GeneTreeiENSGT00550000074366.
HOVERGENiHBG051917.
InParanoidiQ9NQ94.
PhylomeDBiQ9NQ94.
TreeFamiTF314932.

Family and domain databases

Gene3Di3.30.160.20. 1 hit.
3.30.70.330. 2 hits.
InterProiIPR033111. A1CF.
IPR014720. dsRBD_dom.
IPR006535. HnRNP_R/Q_splicing_fac.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PANTHERiPTHR24012:SF313. PTHR24012:SF313. 3 hits.
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01648. hnRNP-R-Q. 1 hit.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9NQ94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESNHKSGDG LSGTQKEAAL RALVQRTGYS LVQENGQRKY GGPPPGWDAA
60 70 80 90 100
PPERGCEIFI GKLPRDLFED ELIPLCEKIG KIYEMRMMMD FNGNNRGYAF
110 120 130 140 150
VTFSNKVEAK NAIKQLNNYE IRNGRLLGVC ASVDNCRLFV GGIPKTKKRE
160 170 180 190 200
EILSEMKKVT EGVVDVIVYP SAADKTKNRG FAFVEYESHR AAAMARRKLL
210 220 230 240 250
PGRIQLWGHG IAVDWAEPEV EVDEDTMSSV KILYVRNLML STSEEMIEKE
260 270 280 290 300
FNNIKPGAVE RVKKIRDYAF VHFSNREDAV EAMKALNGKV LDGSPIEVTL
310 320 330 340 350
AKPVDKDSYV RYTRGTGGRG TMLQGEYTYS LGQVYDPTTT YLGAPVFYAP
360 370 380 390 400
QTYAAIPSLH FPATKGHLSN RAIIRAPSVR EIYMNVPVGA AGVRGLGGRG
410 420 430 440 450
YLAYTGLGRG YQVKGDKRED KLYDILPGME LTPMNPVTLK PQGIKLAPQI
460 470 480 490 500
LEEICQKNNW GQPVYQLHSA IGQDQRQLFL YKITIPALAS QNPAIHPFTP
510 520 530 540 550
PKLSAFVDEA KTYAAEYTLQ TLGIPTDGGD GTMATAAAAA TAFPGYAVPN
560 570 580 590
ATAPVSAAQL KQAVTLGQDL AAYTTYEVYP TFAVTARGDG YGTF
Length:594
Mass (Da):65,202
Last modified:October 1, 2000 - v1
Checksum:iAA5EF76BD8815807
GO
Isoform 22 Publications (identifier: Q9NQ94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-388: Missing.

Note: Major isoform found in 66-78% of cDNA clones.1 Publication
Show »
Length:586
Mass (Da):64,256
Checksum:iA836BBA98FD1BD51
GO
Isoform 3 (identifier: Q9NQ94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MLCSPSFCKLCWKRKK
     381-388: Missing.

Show »
Length:569
Mass (Da):62,682
Checksum:iF185421309CBA29F
GO
Isoform 4Curated (identifier: Q9NQ94-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEK
     381-388: Missing.

Note: Does not exhibit APOBEC1 complementation activity.Curated1 Publication
Show »
Length:594
Mass (Da):65,024
Checksum:i2F2C8897629F9E3C
GO
Isoform 51 Publication (identifier: Q9NQ94-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-84: Missing.

Note: Does not exhibit APOBEC1 complementation activity.1 Publication
Show »
Length:510
Mass (Da):55,962
Checksum:i70E050F5DB3F4DA2
GO
Isoform 61 Publication (identifier: Q9NQ94-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-256: Missing.

Note: Minor isoform found in 2-3% of cDNA clones.1 Publication
Show »
Length:539
Mass (Da):58,871
Checksum:i924E9C2A43A6788C
GO

Sequence cautioni

The sequence BAA91086 differs from that shown. Reason: Frameshift at position 148.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191A → T in AAF34824 (PubMed:10669759).Curated1
Sequence conflicti277E → K (PubMed:10669759).Curated1
Sequence conflicti277E → K (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052201555V → M.Corresponds to variant rs9073dbSNPEnsembl.1
Natural variantiVAR_059821558A → S.Corresponds to variant rs11817448dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0519251 – 84Missing in isoform 5. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_0519261 – 33MESNH…YSLVQ → MLCSPSFCKLCWKRKK in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0519271 – 33MESNH…YSLVQ → MEAVCLGTCPEPEASMSTAI PGLKKGNNALQSIILQTLLE K in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_051928202 – 256Missing in isoform 6. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_051929381 – 388Missing in isoform 2, isoform 3 and isoform 4. 5 Publications8

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272078 mRNA. Translation: CAB94754.1.
AJ272079 mRNA. Translation: CAB94755.1.
AF209192 mRNA. Translation: AAF34824.1.
AF271789 mRNA. Translation: AAF76221.1.
AF271790 mRNA. Translation: AAF76222.1.
AK000324 mRNA. Translation: BAA91086.1. Frameshift.
AK291982 mRNA. Translation: BAF84671.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14233.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14235.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14236.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15762.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15763.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15764.1.
CH471083 Genomic DNA. Translation: EAW54133.1.
CH471083 Genomic DNA. Translation: EAW54134.1.
CH471083 Genomic DNA. Translation: EAW54135.1.
BC130519 mRNA. Translation: AAI30520.1.
BC144196 mRNA. Translation: AAI44197.1.
CCDSiCCDS7241.1. [Q9NQ94-2]
CCDS7242.1. [Q9NQ94-1]
CCDS7243.1. [Q9NQ94-4]
RefSeqiNP_001185747.1. NM_001198818.1. [Q9NQ94-2]
NP_001185748.1. NM_001198819.1.
NP_001185749.1. NM_001198820.1. [Q9NQ94-4]
NP_055391.2. NM_014576.3. [Q9NQ94-2]
NP_620310.1. NM_138932.2. [Q9NQ94-1]
NP_620311.1. NM_138933.2. [Q9NQ94-4]
XP_005269775.1. XM_005269718.2. [Q9NQ94-1]
XP_005269777.1. XM_005269720.3. [Q9NQ94-1]
XP_016871649.1. XM_017016160.1. [Q9NQ94-2]
UniGeneiHs.282795.

Genome annotation databases

EnsembliENST00000282641; ENSP00000282641; ENSG00000148584. [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584. [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584. [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584. [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584. [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584. [Q9NQ94-4]
GeneIDi29974.
KEGGihsa:29974.
UCSCiuc001jjh.4. human. [Q9NQ94-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272078 mRNA. Translation: CAB94754.1.
AJ272079 mRNA. Translation: CAB94755.1.
AF209192 mRNA. Translation: AAF34824.1.
AF271789 mRNA. Translation: AAF76221.1.
AF271790 mRNA. Translation: AAF76222.1.
AK000324 mRNA. Translation: BAA91086.1. Frameshift.
AK291982 mRNA. Translation: BAF84671.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14233.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14235.1.
AL512366, AL589794 Genomic DNA. Translation: CAI14236.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15762.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15763.1.
AL589794, AL512366 Genomic DNA. Translation: CAI15764.1.
CH471083 Genomic DNA. Translation: EAW54133.1.
CH471083 Genomic DNA. Translation: EAW54134.1.
CH471083 Genomic DNA. Translation: EAW54135.1.
BC130519 mRNA. Translation: AAI30520.1.
BC144196 mRNA. Translation: AAI44197.1.
CCDSiCCDS7241.1. [Q9NQ94-2]
CCDS7242.1. [Q9NQ94-1]
CCDS7243.1. [Q9NQ94-4]
RefSeqiNP_001185747.1. NM_001198818.1. [Q9NQ94-2]
NP_001185748.1. NM_001198819.1.
NP_001185749.1. NM_001198820.1. [Q9NQ94-4]
NP_055391.2. NM_014576.3. [Q9NQ94-2]
NP_620310.1. NM_138932.2. [Q9NQ94-1]
NP_620311.1. NM_138933.2. [Q9NQ94-4]
XP_005269775.1. XM_005269718.2. [Q9NQ94-1]
XP_005269777.1. XM_005269720.3. [Q9NQ94-1]
XP_016871649.1. XM_017016160.1. [Q9NQ94-2]
UniGeneiHs.282795.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CPDNMR-A223-308[»]
ProteinModelPortaliQ9NQ94.
SMRiQ9NQ94.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119004. 11 interactors.
IntActiQ9NQ94. 10 interactors.
STRINGi9606.ENSP00000282641.

PTM databases

iPTMnetiQ9NQ94.
PhosphoSitePlusiQ9NQ94.

Polymorphism and mutation databases

BioMutaiA1CF.
DMDMi74761651.

Proteomic databases

MaxQBiQ9NQ94.
PaxDbiQ9NQ94.
PeptideAtlasiQ9NQ94.
PRIDEiQ9NQ94.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282641; ENSP00000282641; ENSG00000148584. [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584. [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584. [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584. [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584. [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584. [Q9NQ94-4]
GeneIDi29974.
KEGGihsa:29974.
UCSCiuc001jjh.4. human. [Q9NQ94-1]

Organism-specific databases

CTDi29974.
DisGeNETi29974.
GeneCardsiA1CF.
HGNCiHGNC:24086. A1CF.
HPAiHPA037779.
HPA044079.
neXtProtiNX_Q9NQ94.
OpenTargetsiENSG00000148584.
PharmGKBiPA162375098.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0117. Eukaryota.
ENOG410XTJ5. LUCA.
GeneTreeiENSGT00550000074366.
HOVERGENiHBG051917.
InParanoidiQ9NQ94.
PhylomeDBiQ9NQ94.
TreeFamiTF314932.

Enzyme and pathway databases

ReactomeiR-HSA-72200. mRNA Editing: C to U Conversion.
R-HSA-75094. Formation of the Editosome.

Miscellaneous databases

ChiTaRSiA1CF. human.
EvolutionaryTraceiQ9NQ94.
GeneWikiiACF_(gene).
GenomeRNAii29974.
PROiQ9NQ94.

Gene expression databases

BgeeiENSG00000148584.
CleanExiHS_A1CF.
ExpressionAtlasiQ9NQ94. baseline and differential.
GenevisibleiQ9NQ94. HS.

Family and domain databases

Gene3Di3.30.160.20. 1 hit.
3.30.70.330. 2 hits.
InterProiIPR033111. A1CF.
IPR014720. dsRBD_dom.
IPR006535. HnRNP_R/Q_splicing_fac.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PANTHERiPTHR24012:SF313. PTHR24012:SF313. 3 hits.
PfamiPF00076. RRM_1. 3 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01648. hnRNP-R-Q. 1 hit.
PROSITEiPS50102. RRM. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiA1CF_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ94
Secondary accession number(s): A1L4F2
, A8K7G7, B7ZM14, Q5SZQ0, Q9NQ93, Q9NQX8, Q9NQX9, Q9NXC9, Q9NZD3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.