Reviewed,
UniProtKB/Swiss-Prot Q9NQ94 (A1CF_HUMAN)
Last modified
November 24, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: APOBEC1 complementation factor Alternative name(s): APOBEC1-stimulating protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 594 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay. Ref.1 Ref.2 Ref.11 |
| Subunit structure | Part of the apolipoprotein B mRNA editing complex with APOBEC1. Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus. Interacts with SYNCRIP. Interacts with CUGBP2 By similarity. Ref.1 Ref.2 Ref.12 UniProtKB Q923K9 |
| Subcellular location | Nucleus. Endoplasmic reticulum By similarity. Cytoplasm. Note: Predominantly nuclear where it localizes to heterochromatin. Also cytoplasmic where it is found at the outer surface of the endoplasmic reticulum By similarity. Shuttles between the nucleus and cytoplasm. May be transported into the nucleus by the nuclear import protein TNPO2/TRN2 or by APOBEC1. |
| Tissue specificity | Widely expressed with highest levels in brain, liver, pancreas, colon and spleen. Ref.2 |
| Domain | The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity. Ref.10 |
| Sequence similarities | Contains 3 RRM (RNA recognition motif) domains. |
| Sequence caution | The sequence BAA91086.1 differs from that shown. Reason: Frameshift at position 148. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA processing |
| Cellular component | Cytoplasm Endoplasmic reticulum Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | RNA-binding |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | mRNA processing Inferred from electronic annotation. Source: UniProtKB-KW protein stabilization Ref.11Inferred from direct assay. Source: UniProtKB |
| Cellular component | apolipoprotein B mRNA editing enzyme complex Ref.1 Inferred from direct assay. Source: UniProtKB endoplasmic reticulumInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | nucleotide binding Inferred from electronic annotation. Source: InterPro protein binding Ref.2 Ref.12Inferred from physical interaction. Source: UniProtKB single-stranded RNA binding Ref.10Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9NQ94-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 Ref.2 Ref.3 (identifier: Q9NQ94-2) The sequence of this isoform differs from the canonical sequence as follows: 381-388: Missing. | ||||||
| Note: Major isoform found in 66-78% of cDNA clones. | ||||||
| Isoform 3 Ref.3 (identifier: Q9NQ94-3) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MLCSPSFCKLCWKRKK 381-388: Missing. | ||||||
| Isoform 4 (identifier: Q9NQ94-4) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEK 381-388: Missing. | ||||||
| Note: Does not exhibit APOBEC1 complementation activity. | ||||||
| Isoform 5 Ref.9 (identifier: Q9NQ94-5) The sequence of this isoform differs from the canonical sequence as follows: 1-84: Missing. | ||||||
| Note: Does not exhibit APOBEC1 complementation activity. | ||||||
| Isoform 6 Ref.9 (identifier: Q9NQ94-6) The sequence of this isoform differs from the canonical sequence as follows: 202-256: Missing. | ||||||
| Note: Minor isoform found in 2-3% of cDNA clones. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 594 | 594 | APOBEC1 complementation factor | PRO_0000081482 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 56 – 134 | 79 | RRM 1 | |||||||||||||||||
| Domain | 136 – 218 | 83 | RRM 2 | |||||||||||||||||
| Domain | 231 – 303 | 73 | RRM 3 | |||||||||||||||||
| Region | 360 – 409 | 50 | Required for nuclear localization Ref.12 | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 1 – 84 | 84 | Missing in isoform 5. Ref.9 | VSP_051925 | ||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MESNH…YSLVQ → MLCSPSFCKLCWKRKK in isoform 3. Ref.3 | VSP_051926 | ||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MESNH…YSLVQ → MEAVCLGTCPEPEASMSTAI PGLKKGNNALQSIILQTLLE K in isoform 4. | VSP_051927 | ||||||||||||||||
| Alternative sequence | 202 – 256 | 55 | Missing in isoform 6. Ref.9 | VSP_051928 | ||||||||||||||||
| Alternative sequence | 381 – 388 | 8 | Missing in isoform 2, isoform 3 and isoform 4. Ref.1 Ref.2 Ref.3 | VSP_051929 | ||||||||||||||||
| Natural variant | 555 | 1 | V → M: dbSNP rs9073. | VAR_052201 | ||||||||||||||||
| Natural variant | 558 | 1 | A → S: dbSNP rs11817448. | VAR_059821 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Mutagenesis | 59 | 1 | F → A: Greatly reduced RNA binding. Ref.10 | |||||||||||||||||
| Mutagenesis | 100 | 1 | F → A: Greatly reduced RNA binding. Ref.10 | |||||||||||||||||
| Mutagenesis | 139 | 1 | F → A: Greatly reduced RNA binding. Ref.10 | |||||||||||||||||
| Mutagenesis | 183 | 1 | F → A: Greatly reduced RNA binding. Ref.10 | |||||||||||||||||
| Mutagenesis | 234 | 1 | Y → A: Slightly reduced RNA binding. Ref.10 | |||||||||||||||||
| Mutagenesis | 270 | 1 | F → A: Slightly reduced RNA binding. Ref.10 | |||||||||||||||||
| Sequence conflict | 191 | 1 | A → T in AAF34824. Ref.2 | |||||||||||||||||
| Sequence conflict | 277 | 1 | E → K Ref.2 | |||||||||||||||||
| Sequence conflict | 277 | 1 | E → K Ref.3 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Beta strand | 232 – 237 | 6 | ||||||||||||||||||
| Helix | 244 – 252 | 9 | ||||||||||||||||||
| Beta strand | 259 – 264 | 6 | ||||||||||||||||||
| Beta strand | 266 – 275 | 10 | ||||||||||||||||||
| Helix | 276 – 286 | 11 | ||||||||||||||||||
| Beta strand | 297 – 299 | 3 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Purification and molecular cloning of a novel essential component of the apolipoprotein B mRNA editing enzyme-complex." Lellek H., Kirsten R., Diehl I., Apostel F., Buck F., Greeve J. J. Biol. Chem. 275:19848-19856(2000) [PubMed: 10781591] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH APOBEC1. Tissue: Liver and Small intestine. |
| [2] | "Molecular cloning of APOBEC-1 complementation factor, a novel RNA-binding protein involved in the editing of apolipoprotein B mRNA." Mehta A., Kinter M.T., Sherman N.E., Driscoll D.M. Mol. Cell. Biol. 20:1846-1854(2000) [PubMed: 10669759] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH APOBEC1, TISSUE SPECIFICITY. |
| [3] | "Human APOBEC-1 complementation factor related protein." Sowden M.P., Smith H.C. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). Tissue: Liver. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Small intestine. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). |
| [8] | "Identification of GRY-RBP as an apolipoprotein B RNA-binding protein that interacts with both apobec-1 and apobec-1 complementation factor to modulate C to U editing." Blanc V., Navaratnam N., Henderson J.O., Anant S., Kennedy S., Jarmuz A., Scott J., Davidson N.O. J. Biol. Chem. 276:10272-10283(2001) [PubMed: 11134005] [Abstract] Cited for: INTERACTION WITH SYNCRIP. |
| [9] | "Isolation, characterization and developmental regulation of the human apobec-1 complementation factor (ACF) gene." Henderson J.O., Blanc V., Davidson N.O. Biochim. Biophys. Acta 1522:22-30(2001) [PubMed: 11718896] [Abstract] Cited for: GENE STRUCTURE, ALTERNATIVE SPLICING. |
| [10] | "Identification of domains in apobec-1 complementation factor required for RNA binding and apolipoprotein-B mRNA editing." Mehta A., Driscoll D.M. RNA 8:69-82(2002) [PubMed: 11871661] [Abstract] Cited for: RNA-BINDING DOMAIN, MUTAGENESIS OF PHE-59; PHE-100; PHE-139; PHE-183; TYR-234 AND PHE-270. |
| [11] | "The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay." Chester A., Somasekaram A., Tzimina M., Jarmuz A., Gisbourne J., O'Keefe R., Scott J., Navaratnam N. EMBO J. 22:3971-3982(2003) [PubMed: 12881431] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [12] | "A novel nuclear localization signal in the auxiliary domain of apobec-1 complementation factor regulates nucleocytoplasmic import and shuttling." Blanc V., Kennedy S., Davidson N.O. J. Biol. Chem. 278:41198-41204(2003) [PubMed: 12896982] [Abstract] Cited for: NUCLEAR LOCALIZATION SIGNAL, INTERACTION WITH TNPO2. |
| [13] | "Solution structure of the RNA recognition motif of human APOBEC-1 complementation factor, ACF." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 223-308. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AJ272078 mRNA. Translation: CAB94754.1. AJ272079 mRNA. Translation: CAB94755.1. AF209192 mRNA. Translation: AAF34824.1. AF271789 mRNA. Translation: AAF76221.1. AF271790 mRNA. Translation: AAF76222.1. AK000324 mRNA. Translation: BAA91086.1. Frameshift. AK291982 mRNA. Translation: BAF84671.1. AL512366, AL589794 Genomic DNA. Translation: CAI14233.1. AL512366, AL589794 Genomic DNA. Translation: CAI14235.1. AL512366, AL589794 Genomic DNA. Translation: CAI14236.1. AL589794, AL512366 Genomic DNA. Translation: CAI15762.1. AL589794, AL512366 Genomic DNA. Translation: CAI15763.1. AL589794, AL512366 Genomic DNA. Translation: CAI15764.1. CH471083 Genomic DNA. Translation: EAW54133.1. CH471083 Genomic DNA. Translation: EAW54134.1. CH471083 Genomic DNA. Translation: EAW54135.1. BC130519 mRNA. Translation: AAI30520.1. BC144196 mRNA. Translation: AAI44197.1. | |||||||||||||
| IPI | IPI00071360. IPI00148257. IPI00299499. IPI00657723. IPI00657770. IPI00657992. | ||||||||||||
| RefSeq | NP_055391.2. NP_620310.1. NP_620311.1. | ||||||||||||
| UniGene | Hs.499643 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | Q9NQ94. Positions 128-230. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | Q9NQ94. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NQ94. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NQ94. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000282641; ENSP00000282641; ENSG00000148584; Homo sapiens. [Genome view] ENST00000373993; ENSP00000363105; ENSG00000148584; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 29974. | ||||||||||||
| KEGG | hsa:29974. | ||||||||||||
| UCSC | uc001jjh.1. human. uc001jji.1. human. uc001jjj.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 29974. | ||||||||||||
| GeneCards | GC10M052237. | ||||||||||||
| H-InvDB | HIX0004173. HIX0008828. | ||||||||||||
| HGNC | HGNC:24086. A1CF. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q9NQ94. | ||||||||||||
| OMA | TMLQGEY | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_1675. mRNA Processing. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NQ94. | ||||||||||||
| Bgee | Q9NQ94. | ||||||||||||
| CleanEx | HS_A1CF. | ||||||||||||
| Genevestigator | Q9NQ94. | ||||||||||||
| GermOnline | ENSG00000148584. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR006535. HnRNP_R/Q_splicing_fac. IPR000504. RRM_RNP1. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 3 hits. | ||||||||||||
| Pfam | PF00076. RRM_1. 3 hits. [Graphical view] | ||||||||||||
| SMART | SM00360. RRM. 3 hits. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR01648. hnRNP-R-Q. 1 hit. | ||||||||||||
| PROSITE | PS50102. RRM. 3 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 52719. | ||||||||||||
Entry information
| Entry name | A1CF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQ94 Secondary accession number(s): A1L4F2 Q9NZD3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


