Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NQ76 (MEPE_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Matrix extracellular phosphoglycoprotein
Alternative name(s):
Osteoblast/osteocyte factor 45
Short name=OF45
Gene names
Name:MEPE
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length525 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Promotes renal phosphate excretion and modulates mineralization. Ref.7

Subcellular location

Secretedextracellular spaceextracellular matrix.

Tissue specificity

Expressed by osteoblasts. Secreted from oncogenic hypophosphataemic tumors.

Post-translational modification

Phosphorylated (in vitro) by FAM20C in the extracellular medium at sites within the S-x-E/pS motif. Ref.8

Binary interactions

With

Entry

#Exp.

IntAct

Notes

NCK1P163333EBI-1753293,EBI-389883

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NQ76-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NQ76-2)

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: R → RITYKGHYEKHGHYVFKCVYMSPEKKNQTDVK
Isoform 3 (identifier: Q9NQ76-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1717 Potential
Chain18 – 525508Matrix extracellular phosphoglycoprotein
PRO_0000021668

Regions

Motif247 – 2493Cell attachment site Potential

Amino acid modifications

Glycosylation4771N-linked (GlcNAc...) Potential
Glycosylation4781N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 113113Missing in isoform 3.
VSP_046892
Alternative sequence361R → RITYKGHYEKHGHYVFKCVY MSPEKKNQTDVK in isoform 2.
VSP_043986
Natural variant3301V → I.
Corresponds to variant rs17013285 [ dbSNP | Ensembl ].
VAR_034094

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 0977CA6E871CA9E5

FASTA52558,419
        10         20         30         40         50         60 
MRVFCVGLLL FSVTWAAPTF QPQTEKTKQS CVEEQRQEEK NKDNIGFHHL GKRINQELSS 

        70         80         90        100        110        120 
KENIVQERKK DLSLSEASEN KGSSKSQNYF TNRQRLNKEY SISNKENTHN GLRMSIYPKS 

       130        140        150        160        170        180 
TGNKGFEDGD DAISKLHDQE EYGAALIRNN MQHIMGPVTA IKLLGEENKE NTPRNVLNII 

       190        200        210        220        230        240 
PASMNYAKAH SKDKKKPQRD SQAQKSPVKS KSTHRIQHNI DYLKHLSKVK KIPSDFEGSG 

       250        260        270        280        290        300 
YTDLQERGDN DISPFSGDGQ PFKDIPGKGE ATGPDLEGKD IQTGFAGPSE AESTHLDTKK 

       310        320        330        340        350        360 
PGYNEIPERE ENGGNTIGTR DETAKEADAV DVSLVEGSND IMGSTNFKEL PGREGNRVDA 

       370        380        390        400        410        420 
GSQNAHQGKV EFHYPPAPSK EKRKEGSSDA AESTNYNEIP KNGKGSTRKG VDHSNRNQAT 

       430        440        450        460        470        480 
LNEKQRFPSK GKSQGLPIPS RGLDNEIKNE MDSFNGPSHE NIITHGRKYH YVPHRQNNST 

       490        500        510        520 
RNKGMPQGKG SWGRQPHSNR RFSSRRRDDS SESSDSGSSS ESDGD 

« Hide

Isoform 2 [UniParc].

Checksum: F475015A4923DA71
Show »

FASTA55662,160
Isoform 3 [UniParc].

Checksum: B93BA6DAFF1D5052
Show »

FASTA41245,291

References

« Hide 'large scale' references
[1]"MEPE, a new gene expressed in bone marrow and tumors causing osteomalacia."
Rowe P.S.N., de Zoysa P.A., Dong R., Wang H.R., White K.E., Econs M.J., Oudet C.L.
Genomics 67:54-68(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Bone.
[2]"Mepe, the gene encoding a tumor-secreted protein in oncogenic hypophosphatemic osteomalacia, is expressed in bone."
Argiro L., Desbarats M., Glorieux F.H., Ecarot B.
Genomics 74:342-351(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Bone.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"A Human MEPE new exon between formerly identified exon 3 and exon 4."
Wang X., Wang Y.
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-101 (ISOFORM 2), ALTERNATIVE SPLICING.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"MEPE has the properties of an osteoblastic phosphatonin and minhibin."
Rowe P.S., Kumagai Y., Gutierrez G., Garrett I.R., Blacher R., Rosen D., Cundy J., Navvab S., Chen D., Drezner M.K., Quarles L.D., Mundy G.R.
Bone 34:303-319(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[8]"Secreted kinase phosphorylates extracellular proteins that regulate biomineralization."
Tagliabracci V.S., Engel J.L., Wen J., Wiley S.E., Worby C.A., Kinch L.N., Xiao J., Grishin N.V., Dixon J.E.
Science 336:1150-1153(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION BY FAM20C.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ276396 mRNA. Translation: CAB97250.1.
AF325916 mRNA. Translation: AAK70343.1.
AC093768 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06001.1.
CH471057 Genomic DNA. Translation: EAX06002.1.
BC128158 mRNA. Translation: AAI28159.1.
DQ854717 mRNA. Translation: ABI64294.1.
RefSeqNP_001171623.1. NM_001184694.1.
NP_001171624.1. NM_001184695.1.
NP_001171625.1. NM_001184696.1.
NP_001171626.1. NM_001184697.1.
NP_064588.1. NM_020203.3.
UniGeneHs.676357.

3D structure databases

ProteinModelPortalQ9NQ76.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121279. 1 interaction.
IntActQ9NQ76. 8 interactions.
STRING9606.ENSP00000354341.

PTM databases

PhosphoSiteQ9NQ76.

Polymorphism databases

DMDM33112396.

Proteomic databases

PaxDbQ9NQ76.
PRIDEQ9NQ76.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000361056; ENSP00000354341; ENSG00000152595. [Q9NQ76-1]
ENST00000395102; ENSP00000378534; ENSG00000152595. [Q9NQ76-2]
ENST00000424957; ENSP00000416984; ENSG00000152595. [Q9NQ76-1]
ENST00000540395; ENSP00000443491; ENSG00000152595. [Q9NQ76-3]
ENST00000560249; ENSP00000453994; ENSG00000152595. [Q9NQ76-3]
GeneID56955.
KEGGhsa:56955.
UCSCuc003hqy.3. human. [Q9NQ76-1]
uc021xpx.1. human. [Q9NQ76-2]

Organism-specific databases

CTD56955.
GeneCardsGC04P088754.
HGNCHGNC:13361. MEPE.
HPAHPA038003.
HPA038004.
MIM605912. gene.
neXtProtNX_Q9NQ76.
PharmGKBPA30755.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG43903.
HOGENOMHOG000115910.
HOVERGENHBG004786.
OMAQNAHQGK.
OrthoDBEOG78SQJP.
PhylomeDBQ9NQ76.
TreeFamTF338655.

Gene expression databases

ArrayExpressQ9NQ76.
BgeeQ9NQ76.
CleanExHS_MEPE.
GenevestigatorQ9NQ76.

Family and domain databases

InterProIPR009837. Osteoregulin.
[Graphical view]
PANTHERPTHR16510. PTHR16510. 1 hit.
PfamPF07175. Osteoregulin. 1 hit.
[Graphical view]
ProDomPD338624. Osteoregulin. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetSearch...

Other

GeneWikiMEPE.
GenomeRNAi56955.
NextBio62571.
PROQ9NQ76.
SOURCESearch...

Entry information

Entry nameMEPE_HUMAN
AccessionPrimary (citable) accession number: Q9NQ76
Secondary accession number(s): A1A4X9 expand/collapse secondary AC list , A8MTA3, D2CFR4, F5H5C5
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: October 1, 2000
Last modified: April 16, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM