Q9NQ76 (MEPE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Matrix extracellular phosphoglycoprotein Alternative name(s): Osteoblast/osteocyte factor 45 Short name=OF45 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 525 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes renal phosphate excretion and modulates mineralization. Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed by osteoblasts. Secreted from oncogenic hypophosphataemic tumors. |
| Post-translational modification | Phosphorylated (in vitro) by FAM20C in the extracellular medium at sites within the S-x-E/pS motif. Ref.8 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Biomineralization |
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | biomineral tissue development Inferred from electronic annotation. Source: UniProtKB-KW negative regulation of bone mineralizationInferred from electronic annotation. Source: Compara skeletal system developmentTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | proteinaceous extracellular matrix Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | extracellular matrix structural constituent Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NCK1 | P16333 | 3 | EBI-1753293,EBI-389883 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NQ76-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NQ76-2) The sequence of this isoform differs from the canonical sequence as follows: 36-36: R → RITYKGHYEKHGHYVFKCVYMSPEKKNQTDVK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Potential | ||||||
| Chain | 18 – 525 | 508 | Matrix extracellular phosphoglycoprotein | PRO_0000021668 | |||||
Regions | |||||||||
| Motif | 247 – 249 | 3 | Cell attachment site Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 477 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 478 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 36 | 1 | R → RITYKGHYEKHGHYVFKCVY MSPEKKNQTDVK in isoform 2. | VSP_043986 | |||||
| Natural variant | 330 | 1 | V → I. Corresponds to variant rs17013285 [ dbSNP | Ensembl ]. | VAR_034094 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MEPE, a new gene expressed in bone marrow and tumors causing osteomalacia." Rowe P.S.N., de Zoysa P.A., Dong R., Wang H.R., White K.E., Econs M.J., Oudet C.L. Genomics 67:54-68(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Bone. |
| [2] | "Mepe, the gene encoding a tumor-secreted protein in oncogenic hypophosphatemic osteomalacia, is expressed in bone." Argiro L., Desbarats M., Glorieux F.H., Ecarot B. Genomics 74:342-351(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Bone. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "A Human MEPE new exon between formerly identified exon 3 and exon 4." Wang X., Wang Y. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-101 (ISOFORM 2), ALTERNATIVE SPLICING. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [7] | "MEPE has the properties of an osteoblastic phosphatonin and minhibin." Rowe P.S., Kumagai Y., Gutierrez G., Garrett I.R., Blacher R., Rosen D., Cundy J., Navvab S., Chen D., Drezner M.K., Quarles L.D., Mundy G.R. Bone 34:303-319(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Secreted kinase phosphorylates extracellular proteins that regulate biomineralization." Tagliabracci V.S., Engel J.L., Wen J., Wiley S.E., Worby C.A., Kinch L.N., Xiao J., Grishin N.V., Dixon J.E. Science 336:1150-1153(2012) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY FAM20C. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ276396 mRNA. Translation: CAB97250.1. AF325916 mRNA. Translation: AAK70343.1. AC093768 Genomic DNA. No translation available. CH471057 Genomic DNA. Translation: EAX06001.1. CH471057 Genomic DNA. Translation: EAX06002.1. BC128158 mRNA. Translation: AAI28159.1. DQ854717 mRNA. Translation: ABI64294.1. |
| IPI | IPI00024648. IPI00791153. |
| RefSeq | NP_001171623.1. NM_001184694.1. NP_001171626.1. NM_001184697.1. NP_064588.1. NM_020203.3. |
| UniGene | Hs.676357. |
3D structure databases | |
| ProteinModelPortal | Q9NQ76. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NQ76. 8 interactions. |
| MINT | MINT-7241428. |
| STRING | 9606.ENSP00000354341. |
PTM databases | |
| PhosphoSite | Q9NQ76. |
Polymorphism databases | |
| DMDM | 33112396. |
Proteomic databases | |
| PaxDb | Q9NQ76. |
| PRIDE | Q9NQ76. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361056; ENSP00000354341; ENSG00000152595. ENST00000395102; ENSP00000378534; ENSG00000152595. ENST00000424957; ENSP00000416984; ENSG00000152595. |
| GeneID | 56955. |
| KEGG | hsa:56955. |
| UCSC | uc003hqy.3. human. |
Organism-specific databases | |
| CTD | 56955. |
| GeneCards | GC04P088754. |
| HGNC | HGNC:13361. MEPE. |
| HPA | HPA038004. |
| MIM | 605912. gene. |
| neXtProt | NX_Q9NQ76. |
| PharmGKB | PA30755. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG43903. |
| HOGENOM | HOG000115910. |
| HOVERGEN | HBG004786. |
| OMA | QNAHQGK. |
| PhylomeDB | Q9NQ76. |
Gene expression databases | |
| ArrayExpress | Q9NQ76. |
| Bgee | Q9NQ76. |
| CleanEx | HS_MEPE. |
| Genevestigator | Q9NQ76. |
| GermOnline | ENSG00000152595. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009837. Osteoregulin. [Graphical view] |
| PANTHER | PTHR16510. PTHR16510. 1 hit. |
| Pfam | PF07175. Osteoregulin. 1 hit. [Graphical view] |
| ProDom | PD338624. Osteoregulin. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 56955. |
| NextBio | 62571. |
| SOURCE | Search... |
Entry information
| Entry name | MEPE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQ76 Secondary accession number(s): A1A4X9, A8MTA3, D2CFR4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
