Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NQ76

- MEPE_HUMAN

UniProt

Q9NQ76 - MEPE_HUMAN

Protein

Matrix extracellular phosphoglycoprotein

Gene

MEPE

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Promotes renal phosphate excretion and modulates mineralization.1 Publication

    GO - Molecular functioni

    1. extracellular matrix structural constituent Source: ProtInc
    2. protein binding Source: IntAct

    GO - Biological processi

    1. biomineral tissue development Source: UniProtKB-KW
    2. negative regulation of bone mineralization Source: Ensembl
    3. regulation of bone remodeling Source: Ensembl
    4. skeletal system development Source: ProtInc

    Keywords - Biological processi

    Biomineralization

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Matrix extracellular phosphoglycoprotein
    Alternative name(s):
    Osteoblast/osteocyte factor 45
    Short name:
    OF45
    Gene namesi
    Name:MEPE
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:13361. MEPE.

    Subcellular locationi

    GO - Cellular componenti

    1. proteinaceous extracellular matrix Source: ProtInc

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30755.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1717Sequence AnalysisAdd
    BLAST
    Chaini18 – 525508Matrix extracellular phosphoglycoproteinPRO_0000021668Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi477 – 4771N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi478 – 4781N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylated (in vitro) by FAM20C in the extracellular medium at sites within the S-x-E/pS motif.1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ9NQ76.
    PRIDEiQ9NQ76.

    PTM databases

    PhosphoSiteiQ9NQ76.

    Expressioni

    Tissue specificityi

    Expressed by osteoblasts. Secreted from oncogenic hypophosphataemic tumors.

    Gene expression databases

    ArrayExpressiQ9NQ76.
    BgeeiQ9NQ76.
    CleanExiHS_MEPE.
    GenevestigatoriQ9NQ76.

    Organism-specific databases

    HPAiHPA038003.
    HPA038004.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    NCK1P163333EBI-1753293,EBI-389883

    Protein-protein interaction databases

    BioGridi121279. 1 interaction.
    IntActiQ9NQ76. 8 interactions.
    STRINGi9606.ENSP00000354341.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NQ76.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi247 – 2493Cell attachment siteSequence Analysis

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG43903.
    HOGENOMiHOG000115910.
    HOVERGENiHBG004786.
    OMAiQNAHQGK.
    OrthoDBiEOG78SQJP.
    PhylomeDBiQ9NQ76.
    TreeFamiTF338655.

    Family and domain databases

    InterProiIPR009837. Osteoregulin.
    [Graphical view]
    PANTHERiPTHR16510. PTHR16510. 1 hit.
    PfamiPF07175. Osteoregulin. 1 hit.
    [Graphical view]
    ProDomiPD338624. Osteoregulin. 1 hit.
    [Graphical view] [Entries sharing at least one domain]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NQ76-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRVFCVGLLL FSVTWAAPTF QPQTEKTKQS CVEEQRQEEK NKDNIGFHHL    50
    GKRINQELSS KENIVQERKK DLSLSEASEN KGSSKSQNYF TNRQRLNKEY 100
    SISNKENTHN GLRMSIYPKS TGNKGFEDGD DAISKLHDQE EYGAALIRNN 150
    MQHIMGPVTA IKLLGEENKE NTPRNVLNII PASMNYAKAH SKDKKKPQRD 200
    SQAQKSPVKS KSTHRIQHNI DYLKHLSKVK KIPSDFEGSG YTDLQERGDN 250
    DISPFSGDGQ PFKDIPGKGE ATGPDLEGKD IQTGFAGPSE AESTHLDTKK 300
    PGYNEIPERE ENGGNTIGTR DETAKEADAV DVSLVEGSND IMGSTNFKEL 350
    PGREGNRVDA GSQNAHQGKV EFHYPPAPSK EKRKEGSSDA AESTNYNEIP 400
    KNGKGSTRKG VDHSNRNQAT LNEKQRFPSK GKSQGLPIPS RGLDNEIKNE 450
    MDSFNGPSHE NIITHGRKYH YVPHRQNNST RNKGMPQGKG SWGRQPHSNR 500
    RFSSRRRDDS SESSDSGSSS ESDGD 525
    Length:525
    Mass (Da):58,419
    Last modified:October 1, 2000 - v1
    Checksum:i0977CA6E871CA9E5
    GO
    Isoform 2 (identifier: Q9NQ76-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         36-36: R → RITYKGHYEKHGHYVFKCVYMSPEKKNQTDVK

    Show »
    Length:556
    Mass (Da):62,160
    Checksum:iF475015A4923DA71
    GO
    Isoform 3 (identifier: Q9NQ76-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-113: Missing.

    Note: Gene prediction based on EST data.

    Show »
    Length:412
    Mass (Da):45,291
    Checksum:iB93BA6DAFF1D5052
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti330 – 3301V → I.
    Corresponds to variant rs17013285 [ dbSNP | Ensembl ].
    VAR_034094

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 113113Missing in isoform 3. CuratedVSP_046892Add
    BLAST
    Alternative sequencei36 – 361R → RITYKGHYEKHGHYVFKCVY MSPEKKNQTDVK in isoform 2. 1 PublicationVSP_043986

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ276396 mRNA. Translation: CAB97250.1.
    AF325916 mRNA. Translation: AAK70343.1.
    AC093768 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06001.1.
    CH471057 Genomic DNA. Translation: EAX06002.1.
    BC128158 mRNA. Translation: AAI28159.1.
    DQ854717 mRNA. Translation: ABI64294.1.
    CCDSiCCDS3625.1. [Q9NQ76-1]
    CCDS54776.1. [Q9NQ76-3]
    RefSeqiNP_001171623.1. NM_001184694.2. [Q9NQ76-1]
    NP_001171624.1. NM_001184695.1. [Q9NQ76-3]
    NP_001171625.1. NM_001184696.1. [Q9NQ76-3]
    NP_001171626.1. NM_001184697.1. [Q9NQ76-3]
    NP_001278112.1. NM_001291183.1. [Q9NQ76-2]
    NP_064588.1. NM_020203.3. [Q9NQ76-1]
    XP_006714341.1. XM_006714278.1. [Q9NQ76-2]
    UniGeneiHs.676357.

    Genome annotation databases

    EnsembliENST00000361056; ENSP00000354341; ENSG00000152595. [Q9NQ76-1]
    ENST00000395102; ENSP00000378534; ENSG00000152595. [Q9NQ76-2]
    ENST00000424957; ENSP00000416984; ENSG00000152595. [Q9NQ76-1]
    ENST00000540395; ENSP00000443491; ENSG00000152595. [Q9NQ76-3]
    ENST00000560249; ENSP00000453994; ENSG00000152595. [Q9NQ76-3]
    GeneIDi56955.
    KEGGihsa:56955.
    UCSCiuc003hqy.3. human. [Q9NQ76-1]
    uc021xpx.1. human. [Q9NQ76-2]

    Polymorphism databases

    DMDMi33112396.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ276396 mRNA. Translation: CAB97250.1 .
    AF325916 mRNA. Translation: AAK70343.1 .
    AC093768 Genomic DNA. No translation available.
    CH471057 Genomic DNA. Translation: EAX06001.1 .
    CH471057 Genomic DNA. Translation: EAX06002.1 .
    BC128158 mRNA. Translation: AAI28159.1 .
    DQ854717 mRNA. Translation: ABI64294.1 .
    CCDSi CCDS3625.1. [Q9NQ76-1 ]
    CCDS54776.1. [Q9NQ76-3 ]
    RefSeqi NP_001171623.1. NM_001184694.2. [Q9NQ76-1 ]
    NP_001171624.1. NM_001184695.1. [Q9NQ76-3 ]
    NP_001171625.1. NM_001184696.1. [Q9NQ76-3 ]
    NP_001171626.1. NM_001184697.1. [Q9NQ76-3 ]
    NP_001278112.1. NM_001291183.1. [Q9NQ76-2 ]
    NP_064588.1. NM_020203.3. [Q9NQ76-1 ]
    XP_006714341.1. XM_006714278.1. [Q9NQ76-2 ]
    UniGenei Hs.676357.

    3D structure databases

    ProteinModelPortali Q9NQ76.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121279. 1 interaction.
    IntActi Q9NQ76. 8 interactions.
    STRINGi 9606.ENSP00000354341.

    PTM databases

    PhosphoSitei Q9NQ76.

    Polymorphism databases

    DMDMi 33112396.

    Proteomic databases

    PaxDbi Q9NQ76.
    PRIDEi Q9NQ76.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361056 ; ENSP00000354341 ; ENSG00000152595 . [Q9NQ76-1 ]
    ENST00000395102 ; ENSP00000378534 ; ENSG00000152595 . [Q9NQ76-2 ]
    ENST00000424957 ; ENSP00000416984 ; ENSG00000152595 . [Q9NQ76-1 ]
    ENST00000540395 ; ENSP00000443491 ; ENSG00000152595 . [Q9NQ76-3 ]
    ENST00000560249 ; ENSP00000453994 ; ENSG00000152595 . [Q9NQ76-3 ]
    GeneIDi 56955.
    KEGGi hsa:56955.
    UCSCi uc003hqy.3. human. [Q9NQ76-1 ]
    uc021xpx.1. human. [Q9NQ76-2 ]

    Organism-specific databases

    CTDi 56955.
    GeneCardsi GC04P088754.
    HGNCi HGNC:13361. MEPE.
    HPAi HPA038003.
    HPA038004.
    MIMi 605912. gene.
    neXtProti NX_Q9NQ76.
    PharmGKBi PA30755.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG43903.
    HOGENOMi HOG000115910.
    HOVERGENi HBG004786.
    OMAi QNAHQGK.
    OrthoDBi EOG78SQJP.
    PhylomeDBi Q9NQ76.
    TreeFami TF338655.

    Miscellaneous databases

    GeneWikii MEPE.
    GenomeRNAii 56955.
    NextBioi 62571.
    PROi Q9NQ76.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NQ76.
    Bgeei Q9NQ76.
    CleanExi HS_MEPE.
    Genevestigatori Q9NQ76.

    Family and domain databases

    InterProi IPR009837. Osteoregulin.
    [Graphical view ]
    PANTHERi PTHR16510. PTHR16510. 1 hit.
    Pfami PF07175. Osteoregulin. 1 hit.
    [Graphical view ]
    ProDomi PD338624. Osteoregulin. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    ProtoNeti Search...

    Publicationsi

    1. "MEPE, a new gene expressed in bone marrow and tumors causing osteomalacia."
      Rowe P.S.N., de Zoysa P.A., Dong R., Wang H.R., White K.E., Econs M.J., Oudet C.L.
      Genomics 67:54-68(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Bone.
    2. "Mepe, the gene encoding a tumor-secreted protein in oncogenic hypophosphatemic osteomalacia, is expressed in bone."
      Argiro L., Desbarats M., Glorieux F.H., Ecarot B.
      Genomics 74:342-351(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Bone.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "A Human MEPE new exon between formerly identified exon 3 and exon 4."
      Wang X., Wang Y.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-101 (ISOFORM 2), ALTERNATIVE SPLICING.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. Cited for: FUNCTION.
    8. "Secreted kinase phosphorylates extracellular proteins that regulate biomineralization."
      Tagliabracci V.S., Engel J.L., Wen J., Wiley S.E., Worby C.A., Kinch L.N., Xiao J., Grishin N.V., Dixon J.E.
      Science 336:1150-1153(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION BY FAM20C.

    Entry informationi

    Entry nameiMEPE_HUMAN
    AccessioniPrimary (citable) accession number: Q9NQ76
    Secondary accession number(s): A1A4X9
    , A8MTA3, D2CFR4, F5H5C5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2003
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3