SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NQ76

- MEPE_HUMAN

UniProt

Q9NQ76 - MEPE_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Matrix extracellular phosphoglycoprotein

Gene
MEPE
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Promotes renal phosphate excretion and modulates mineralization.1 Publication

GO - Molecular functioni

  1. extracellular matrix structural constituent Source: ProtInc
  2. protein binding Source: IntAct

GO - Biological processi

  1. biomineral tissue development Source: UniProtKB-KW
  2. negative regulation of bone mineralization Source: Ensembl
  3. regulation of bone remodeling Source: Ensembl
  4. skeletal system development Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Biomineralization

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix extracellular phosphoglycoprotein
Alternative name(s):
Osteoblast/osteocyte factor 45
Short name:
OF45
Gene namesi
Name:MEPE
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:13361. MEPE.

Subcellular locationi

GO - Cellular componenti

  1. proteinaceous extracellular matrix Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30755.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717 Reviewed predictionAdd
BLAST
Chaini18 – 525508Matrix extracellular phosphoglycoproteinPRO_0000021668Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi477 – 4771N-linked (GlcNAc...) Reviewed prediction
Glycosylationi478 – 4781N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Phosphorylated (in vitro) by FAM20C in the extracellular medium at sites within the S-x-E/pS motif.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9NQ76.
PRIDEiQ9NQ76.

PTM databases

PhosphoSiteiQ9NQ76.

Expressioni

Tissue specificityi

Expressed by osteoblasts. Secreted from oncogenic hypophosphataemic tumors.

Gene expression databases

ArrayExpressiQ9NQ76.
BgeeiQ9NQ76.
CleanExiHS_MEPE.
GenevestigatoriQ9NQ76.

Organism-specific databases

HPAiHPA038003.
HPA038004.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
NCK1P163333EBI-1753293,EBI-389883

Protein-protein interaction databases

BioGridi121279. 1 interaction.
IntActiQ9NQ76. 8 interactions.
STRINGi9606.ENSP00000354341.

Structurei

3D structure databases

ProteinModelPortaliQ9NQ76.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi247 – 2493Cell attachment site Reviewed prediction

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG43903.
HOGENOMiHOG000115910.
HOVERGENiHBG004786.
OMAiQNAHQGK.
OrthoDBiEOG78SQJP.
PhylomeDBiQ9NQ76.
TreeFamiTF338655.

Family and domain databases

InterProiIPR009837. Osteoregulin.
[Graphical view]
PANTHERiPTHR16510. PTHR16510. 1 hit.
PfamiPF07175. Osteoregulin. 1 hit.
[Graphical view]
ProDomiPD338624. Osteoregulin. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NQ76-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRVFCVGLLL FSVTWAAPTF QPQTEKTKQS CVEEQRQEEK NKDNIGFHHL    50
GKRINQELSS KENIVQERKK DLSLSEASEN KGSSKSQNYF TNRQRLNKEY 100
SISNKENTHN GLRMSIYPKS TGNKGFEDGD DAISKLHDQE EYGAALIRNN 150
MQHIMGPVTA IKLLGEENKE NTPRNVLNII PASMNYAKAH SKDKKKPQRD 200
SQAQKSPVKS KSTHRIQHNI DYLKHLSKVK KIPSDFEGSG YTDLQERGDN 250
DISPFSGDGQ PFKDIPGKGE ATGPDLEGKD IQTGFAGPSE AESTHLDTKK 300
PGYNEIPERE ENGGNTIGTR DETAKEADAV DVSLVEGSND IMGSTNFKEL 350
PGREGNRVDA GSQNAHQGKV EFHYPPAPSK EKRKEGSSDA AESTNYNEIP 400
KNGKGSTRKG VDHSNRNQAT LNEKQRFPSK GKSQGLPIPS RGLDNEIKNE 450
MDSFNGPSHE NIITHGRKYH YVPHRQNNST RNKGMPQGKG SWGRQPHSNR 500
RFSSRRRDDS SESSDSGSSS ESDGD 525
Length:525
Mass (Da):58,419
Last modified:October 1, 2000 - v1
Checksum:i0977CA6E871CA9E5
GO
Isoform 2 (identifier: Q9NQ76-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: R → RITYKGHYEKHGHYVFKCVYMSPEKKNQTDVK

Show »
Length:556
Mass (Da):62,160
Checksum:iF475015A4923DA71
GO
Isoform 3 (identifier: Q9NQ76-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.

Note: Gene prediction based on EST data.

Show »
Length:412
Mass (Da):45,291
Checksum:iB93BA6DAFF1D5052
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti330 – 3301V → I.
Corresponds to variant rs17013285 [ dbSNP | Ensembl ].
VAR_034094

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 113113Missing in isoform 3. VSP_046892Add
BLAST
Alternative sequencei36 – 361R → RITYKGHYEKHGHYVFKCVY MSPEKKNQTDVK in isoform 2. VSP_043986

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ276396 mRNA. Translation: CAB97250.1.
AF325916 mRNA. Translation: AAK70343.1.
AC093768 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06001.1.
CH471057 Genomic DNA. Translation: EAX06002.1.
BC128158 mRNA. Translation: AAI28159.1.
DQ854717 mRNA. Translation: ABI64294.1.
CCDSiCCDS3625.1. [Q9NQ76-1]
CCDS54776.1. [Q9NQ76-3]
RefSeqiNP_001171623.1. NM_001184694.2. [Q9NQ76-1]
NP_001171624.1. NM_001184695.1. [Q9NQ76-3]
NP_001171625.1. NM_001184696.1. [Q9NQ76-3]
NP_001171626.1. NM_001184697.1. [Q9NQ76-3]
NP_001278112.1. NM_001291183.1. [Q9NQ76-2]
NP_064588.1. NM_020203.3. [Q9NQ76-1]
XP_006714341.1. XM_006714278.1. [Q9NQ76-2]
UniGeneiHs.676357.

Genome annotation databases

EnsembliENST00000361056; ENSP00000354341; ENSG00000152595. [Q9NQ76-1]
ENST00000395102; ENSP00000378534; ENSG00000152595. [Q9NQ76-2]
ENST00000424957; ENSP00000416984; ENSG00000152595. [Q9NQ76-1]
ENST00000540395; ENSP00000443491; ENSG00000152595. [Q9NQ76-3]
ENST00000560249; ENSP00000453994; ENSG00000152595. [Q9NQ76-3]
GeneIDi56955.
KEGGihsa:56955.
UCSCiuc003hqy.3. human. [Q9NQ76-1]
uc021xpx.1. human. [Q9NQ76-2]

Polymorphism databases

DMDMi33112396.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ276396 mRNA. Translation: CAB97250.1 .
AF325916 mRNA. Translation: AAK70343.1 .
AC093768 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06001.1 .
CH471057 Genomic DNA. Translation: EAX06002.1 .
BC128158 mRNA. Translation: AAI28159.1 .
DQ854717 mRNA. Translation: ABI64294.1 .
CCDSi CCDS3625.1. [Q9NQ76-1 ]
CCDS54776.1. [Q9NQ76-3 ]
RefSeqi NP_001171623.1. NM_001184694.2. [Q9NQ76-1 ]
NP_001171624.1. NM_001184695.1. [Q9NQ76-3 ]
NP_001171625.1. NM_001184696.1. [Q9NQ76-3 ]
NP_001171626.1. NM_001184697.1. [Q9NQ76-3 ]
NP_001278112.1. NM_001291183.1. [Q9NQ76-2 ]
NP_064588.1. NM_020203.3. [Q9NQ76-1 ]
XP_006714341.1. XM_006714278.1. [Q9NQ76-2 ]
UniGenei Hs.676357.

3D structure databases

ProteinModelPortali Q9NQ76.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121279. 1 interaction.
IntActi Q9NQ76. 8 interactions.
STRINGi 9606.ENSP00000354341.

PTM databases

PhosphoSitei Q9NQ76.

Polymorphism databases

DMDMi 33112396.

Proteomic databases

PaxDbi Q9NQ76.
PRIDEi Q9NQ76.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361056 ; ENSP00000354341 ; ENSG00000152595 . [Q9NQ76-1 ]
ENST00000395102 ; ENSP00000378534 ; ENSG00000152595 . [Q9NQ76-2 ]
ENST00000424957 ; ENSP00000416984 ; ENSG00000152595 . [Q9NQ76-1 ]
ENST00000540395 ; ENSP00000443491 ; ENSG00000152595 . [Q9NQ76-3 ]
ENST00000560249 ; ENSP00000453994 ; ENSG00000152595 . [Q9NQ76-3 ]
GeneIDi 56955.
KEGGi hsa:56955.
UCSCi uc003hqy.3. human. [Q9NQ76-1 ]
uc021xpx.1. human. [Q9NQ76-2 ]

Organism-specific databases

CTDi 56955.
GeneCardsi GC04P088754.
HGNCi HGNC:13361. MEPE.
HPAi HPA038003.
HPA038004.
MIMi 605912. gene.
neXtProti NX_Q9NQ76.
PharmGKBi PA30755.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG43903.
HOGENOMi HOG000115910.
HOVERGENi HBG004786.
OMAi QNAHQGK.
OrthoDBi EOG78SQJP.
PhylomeDBi Q9NQ76.
TreeFami TF338655.

Miscellaneous databases

GeneWikii MEPE.
GenomeRNAii 56955.
NextBioi 62571.
PROi Q9NQ76.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NQ76.
Bgeei Q9NQ76.
CleanExi HS_MEPE.
Genevestigatori Q9NQ76.

Family and domain databases

InterProi IPR009837. Osteoregulin.
[Graphical view ]
PANTHERi PTHR16510. PTHR16510. 1 hit.
Pfami PF07175. Osteoregulin. 1 hit.
[Graphical view ]
ProDomi PD338624. Osteoregulin. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "MEPE, a new gene expressed in bone marrow and tumors causing osteomalacia."
    Rowe P.S.N., de Zoysa P.A., Dong R., Wang H.R., White K.E., Econs M.J., Oudet C.L.
    Genomics 67:54-68(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Bone.
  2. "Mepe, the gene encoding a tumor-secreted protein in oncogenic hypophosphatemic osteomalacia, is expressed in bone."
    Argiro L., Desbarats M., Glorieux F.H., Ecarot B.
    Genomics 74:342-351(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Bone.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "A Human MEPE new exon between formerly identified exon 3 and exon 4."
    Wang X., Wang Y.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-101 (ISOFORM 2), ALTERNATIVE SPLICING.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. Cited for: FUNCTION.
  8. "Secreted kinase phosphorylates extracellular proteins that regulate biomineralization."
    Tagliabracci V.S., Engel J.L., Wen J., Wiley S.E., Worby C.A., Kinch L.N., Xiao J., Grishin N.V., Dixon J.E.
    Science 336:1150-1153(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY FAM20C.

Entry informationi

Entry nameiMEPE_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ76
Secondary accession number(s): A1A4X9
, A8MTA3, D2CFR4, F5H5C5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi