Q9NQ66 (PLCB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 EC=3.1.4.11 Alternative name(s): PLC-154 Phosphoinositide phospholipase C-beta-1 Phospholipase C-I Short name=PLC-I Phospholipase C-beta-1 Short name=PLC-beta-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1216 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium. |
| Subunit structure | Interacts with DGKQ. Ref.10 |
| Subcellular location | Nucleus membrane By similarity. Cytoplasm By similarity. Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes By similarity. |
| Involvement in disease | Epileptic encephalopathy, early infantile, 12 (EIEE12) [MIM:613722]: A form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG. |
| Miscellaneous | The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
| Sequence caution | The sequence BAA25507.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB14641.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9NQ66-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9NQ66-2) The sequence of this isoform differs from the canonical sequence as follows: 1142-1216: LQVELEQEYQ...IPGKEFDTPL → GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1216 | 1216 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 | PRO_0000088486 | |||||
Regions | |||||||||
| Domain | 316 – 467 | 152 | PI-PLC X-box | ||||||
| Domain | 540 – 656 | 117 | PI-PLC Y-box | ||||||
| Domain | 663 – 761 | 99 | C2 | ||||||
Sites | |||||||||
| Active site | 331 | 1 | By similarity | ||||||
| Active site | 378 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 333 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 334 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 336 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 887 | 1 | Phosphoserine; by PKC By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1142 – 1216 | 75 | LQVEL…FDTPL → GEGSSSFLSETCHEDPSVSP NFTPPNPQALKW in isoform B. | VSP_004718 | |||||
| Natural variant | 854 | 1 | E → K. Corresponds to variant rs2076413 [ dbSNP | Ensembl ]. | VAR_050541 | |||||
| Natural variant | 907 | 1 | A → P in a breast cancer sample; somatic mutation. Ref.12 | VAR_036547 | |||||
Experimental info | |||||||||
| Sequence conflict | 1 – 34 | 34 | MAGAQ…KWDDD → MGSLQGIATKILIRILSDAL IRKETDLKS in AAF86613. Ref.2 | ||||||
| Sequence conflict | 189 | 1 | L → M in AAF86613. Ref.2 | ||||||
| Sequence conflict | 203 | 1 | P → L in AAF86613. Ref.2 | ||||||
| Sequence conflict | 216 | 1 | L → F in AAF86613. Ref.2 | ||||||
| Sequence conflict | 221 | 1 | P → L in AAF86613. Ref.2 | ||||||
| Sequence conflict | 266 | 1 | L → P in AAF86613. Ref.2 | ||||||
| Sequence conflict | 309 | 1 | P → T in AAF86613. Ref.2 | ||||||
| Sequence conflict | 320 | 1 | Q → R in AAF86613. Ref.2 | ||||||
| Sequence conflict | 352 | 1 | V → A in AAF86613. Ref.2 | ||||||
| Sequence conflict | 366 | 1 | K → R in AAF86613. Ref.2 | ||||||
| Sequence conflict | 393 | 1 | E → K in AAF86613. Ref.2 | ||||||
| Sequence conflict | 983 | 1 | P → S in CAB98143. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ278313 mRNA. Translation: CAB98142.1. AJ278314 mRNA. Translation: CAB98143.1. AY004175 mRNA. Translation: AAF86613.1. AB011153 mRNA. Translation: BAA25507.3. Different initiation. AL031683 AL050323 Genomic DNA. Translation: CAI43121.1.AL031683 AL050323 Genomic DNA. Translation: CAI43122.1.AL034551 AL050323 Genomic DNA. Translation: CAI21973.1.AL034551 AL050323 Genomic DNA. Translation: CAI21974.1.AL049593 AL050323 Genomic DNA. Translation: CAI22175.1.AL049632 AL050323 Genomic DNA. Translation: CAI43151.1.AL049632 AL050323 Genomic DNA. Translation: CAI43152.1.AL050315 AL050323 Genomic DNA. Translation: CAI42238.1.AL050315 AL050323 Genomic DNA. Translation: CAI42239.1.AL050323 AL050315 Genomic DNA. Translation: CAI22830.1.AL050323 AL049632 Genomic DNA. Translation: CAI22831.1.CH471133 Genomic DNA. Translation: EAX10372.1. CH471133 Genomic DNA. Translation: EAX10373.1. CH471133 Genomic DNA. Translation: EAX10374.1. CH471133 Genomic DNA. Translation: EAX10376.1. BC069420 mRNA. Translation: AAH69420.1. BC117231 mRNA. Translation: AAI17232.1. AL137267 mRNA. Translation: CAB70666.1. AK023689 mRNA. Translation: BAB14641.1. Different initiation. |
| IPI | IPI00219563. IPI00395561. |
| RefSeq | NP_056007.1. NM_015192.3. NP_877398.1. NM_182734.2. |
| UniGene | Hs.431173. |
3D structure databases | |
| ProteinModelPortal | Q9NQ66. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NQ66. 1 interaction. |
PTM databases | |
| PhosphoSite | Q9NQ66. |
Polymorphism databases | |
| DMDM | 12643814. |
Proteomic databases | |
| PaxDb | Q9NQ66. |
| PRIDE | Q9NQ66. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338037; ENSP00000338185; ENSG00000182621. ENST00000378637; ENSP00000367904; ENSG00000182621. ENST00000378641; ENSP00000367908; ENSG00000182621. |
| GeneID | 23236. |
| KEGG | hsa:23236. |
| UCSC | uc002wna.3. human. uc002wnb.3. human. |
Organism-specific databases | |
| CTD | 23236. |
| GeneCards | GC20P008061. |
| HGNC | HGNC:15917. PLCB1. |
| HPA | CAB004275. CAB005334. |
| MIM | 607120. gene. 613722. phenotype. |
| neXtProt | NX_Q9NQ66. |
| Orphanet | 1934. Early infantile epileptic encephalopathy. |
| PharmGKB | PA33384. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG149692. |
| HOVERGEN | HBG053609. |
| InParanoid | Q9NQ66. |
| KO | K05858. |
| OMA | YRVFLNN. |
| PhylomeDB | Q9NQ66. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 2681. |
| Pathway_Interaction_DB | endothelinpathway. Endothelins. er_nongenomic_pathway. Plasma membrane estrogen receptor signaling. |
| Reactome | REACT_111102. Signal Transduction. REACT_111217. Metabolism. REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | Q9NQ66. |
| Bgee | Q9NQ66. |
| Genevestigator | Q9NQ66. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 1 hit. 3.20.20.190. 2 hits. |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR001192. Pinositol_PLipase_C. IPR016280. PLC-beta. IPR014815. PLC-beta_C. IPR009535. PLC-beta_CS. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR015359. PLipase_C_EF-hand-like. IPR000909. PLipase_C_PInositol-sp_X_dom. IPR001711. PLipase_C_Pinositol-sp_Y. [Graphical view] |
| PANTHER | PTHR10336. PTHR10336. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF06631. DUF1154. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. PF08703. PLC-beta_C. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9NQ66. |
| ChEMBL | CHEMBL4034. |
| ChiTaRS | PLCB1. human. |
| GenomeRNAi | 23236. |
| NextBio | 44882. |
| SOURCE | Search... |
Entry information
| Entry name | PLCB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQ66 Secondary accession number(s): D3DW12 Q9UM26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
