Q9NQ66 (PLCB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1 EC=3.1.4.11 Alternative name(s): PLC-154 Phosphoinositide phospholipase C-beta-1 Phospholipase C-I Short name=PLC-I Phospholipase C-beta-1 Short name=PLC-beta-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1216 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium. |
| Subunit structure | Interacts with DGKQ. Ref.10 |
| Involvement in disease | Defects in PLCB1 are the cause of epileptic encephalopathy early infantile type 12 (EIEE12) [MIM:613722]. EIEE12 is a form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG. Ref.13 |
| Miscellaneous | The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
| Sequence caution | The sequence BAA25507.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB14641.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9NQ66-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9NQ66-2) The sequence of this isoform differs from the canonical sequence as follows: 1142-1216: LQVELEQEYQ...IPGKEFDTPL → GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1216 | 1216 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1 | PRO_0000088486 | |||||
Regions | |||||||||
| Domain | 316 – 467 | 152 | PI-PLC X-box | ||||||
| Domain | 540 – 656 | 117 | PI-PLC Y-box | ||||||
| Domain | 663 – 761 | 99 | C2 | ||||||
Sites | |||||||||
| Active site | 331 | 1 | By similarity | ||||||
| Active site | 378 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 333 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 334 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 336 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 569 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 573 | 1 | Phosphothreonine Ref.12 | ||||||
| Modified residue | 887 | 1 | Phosphoserine; by PKC By similarity | ||||||
| Modified residue | 972 | 1 | N6-acetyllysine Ref.11 | ||||||
| Modified residue | 976 | 1 | N6-acetyllysine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1142 – 1216 | 75 | LQVEL…FDTPL → GEGSSSFLSETCHEDPSVSP NFTPPNPQALKW in isoform B. | VSP_004718 | |||||
| Natural variant | 854 | 1 | E → K. Corresponds to variant rs2076413 [ dbSNP | Ensembl ]. | VAR_050541 | |||||
| Natural variant | 907 | 1 | A → P in a breast cancer sample; somatic mutation. Ref.14 | VAR_036547 | |||||
Experimental info | |||||||||
| Sequence conflict | 1 – 34 | 34 | MAGAQ…KWDDD → MGSLQGIATKILIRILSDAL IRKETDLKS in AAF86613. Ref.2 | ||||||
| Sequence conflict | 189 | 1 | L → M in AAF86613. Ref.2 | ||||||
| Sequence conflict | 203 | 1 | P → L in AAF86613. Ref.2 | ||||||
| Sequence conflict | 216 | 1 | L → F in AAF86613. Ref.2 | ||||||
| Sequence conflict | 221 | 1 | P → L in AAF86613. Ref.2 | ||||||
| Sequence conflict | 266 | 1 | L → P in AAF86613. Ref.2 | ||||||
| Sequence conflict | 309 | 1 | P → T in AAF86613. Ref.2 | ||||||
| Sequence conflict | 320 | 1 | Q → R in AAF86613. Ref.2 | ||||||
| Sequence conflict | 352 | 1 | V → A in AAF86613. Ref.2 | ||||||
| Sequence conflict | 366 | 1 | K → R in AAF86613. Ref.2 | ||||||
| Sequence conflict | 393 | 1 | E → K in AAF86613. Ref.2 | ||||||
| Sequence conflict | 983 | 1 | P → S in CAB98143. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLCbeta1)." Caricasole A., Sala C., Roncarati R., Formenti E., Terstappen G.C. Biochim. Biophys. Acta 1517:63-72(2000) [PubMed: 11118617] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). Tissue: Brain. |
| [2] | "Identification and chromosomal localisation by fluorescence in situ hybridisation of human gene of phosphoinositide-specific phospholipase C beta 1." Peruzzi D., Calabrese G., Faenza I., Manzoli L., Matteucci A., Gianfrancesco F., Billi A.M., Stuppia L., Palka G., Cocco L. Biochim. Biophys. Acta 1484:175-182(2000) [PubMed: 10760467] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Tissue: Brain. |
| [3] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed: 9628581] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Brain. |
| [4] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B). Tissue: Brain. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1216 (ISOFORM B). Tissue: Testis. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 417-1062 (ISOFORMS A AND B). Tissue: Placenta. |
| [10] | "Diacylglycerol kinase-theta is localized in the speckle domains of the nucleus." Tabellini G., Bortul R., Santi S., Riccio M., Baldini G., Cappellini A., Billi A.M., Berezney R., Ruggeri A., Cocco L., Martelli A.M. Exp. Cell Res. 287:143-154(2003) [PubMed: 12799190] [Abstract] Cited for: INTERACTION WITH DGKQ. |
| [11] | "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T., Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y. Mol. Cell 23:607-618(2006) [PubMed: 16916647] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-972 AND LYS-976, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-569 AND THR-573, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Phospholipase C beta 1 deficiency is associated with early-onset epileptic encephalopathy." Kurian M.A., Meyer E., Vassallo G., Morgan N.V., Prakash N., Pasha S., Hai N.A., Shuib S., Rahman F., Wassmer E., Cross J.H., O'Callaghan F.J., Osborne J.P., Scheffer I.E., Gissen P., Maher E.R. Brain 133:2964-2970(2010) [PubMed: 20833646] [Abstract] Cited for: INVOLVEMENT IN EIEE12. |
| [14] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] PRO-907. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ278313 mRNA. Translation: CAB98142.1. AJ278314 mRNA. Translation: CAB98143.1. AY004175 mRNA. Translation: AAF86613.1. AB011153 mRNA. Translation: BAA25507.3. Different initiation. AL031683 AL050323 Genomic DNA. Translation: CAI43121.1.AL031683 AL050323 Genomic DNA. Translation: CAI43122.1.AL034551 AL050323 Genomic DNA. Translation: CAI21973.1.AL034551 AL050323 Genomic DNA. Translation: CAI21974.1.AL049593 AL050323 Genomic DNA. Translation: CAI22175.1.AL049632 AL050323 Genomic DNA. Translation: CAI43151.1.AL049632 AL050323 Genomic DNA. Translation: CAI43152.1.AL050315 AL050323 Genomic DNA. Translation: CAI42238.1.AL050315 AL050323 Genomic DNA. Translation: CAI42239.1.AL050323 AL050315 Genomic DNA. Translation: CAI22830.1.AL050323 AL049632 Genomic DNA. Translation: CAI22831.1.CH471133 Genomic DNA. Translation: EAX10372.1. CH471133 Genomic DNA. Translation: EAX10373.1. CH471133 Genomic DNA. Translation: EAX10374.1. CH471133 Genomic DNA. Translation: EAX10376.1. BC069420 mRNA. Translation: AAH69420.1. BC117231 mRNA. Translation: AAI17232.1. AL137267 mRNA. Translation: CAB70666.1. AK023689 mRNA. Translation: BAB14641.1. Different initiation. |
| IPI | IPI00219563. IPI00395561. |
| RefSeq | NP_056007.1. NM_015192.2. NP_877398.1. NM_182734.1. |
| UniGene | Hs.431173. |
3D structure databases | |
| ProteinModelPortal | Q9NQ66. |
| SMR | Q9NQ66. Positions 12-833. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NQ66. 1 interaction. |
| STRING | Q9NQ66. |
PTM databases | |
| PhosphoSite | Q9NQ66. |
Polymorphism databases | |
| DMDM | 12643814. |
Proteomic databases | |
| PRIDE | Q9NQ66. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338037; ENSP00000338185; ENSG00000182621. |
| GeneID | 23236. |
| KEGG | hsa:23236. |
| UCSC | uc002wna.1. human. uc002wnb.1. human. |
Organism-specific databases | |
| CTD | 23236. |
| GeneCards | GC20P008061. |
| H-InvDB | HIX0015634. |
| HGNC | HGNC:15917. PLCB1. |
| HPA | CAB004275. CAB005334. |
| MIM | 607120. gene. 613722. phenotype. |
| neXtProt | NX_Q9NQ66. |
| Orphanet | 1934. Early infantile epileptic encephalopathy. |
| PharmGKB | PA33384. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05575. |
| GeneTree | ENSGT00600000084213. |
| HOVERGEN | HBG053609. |
| InParanoid | Q9NQ66. |
| OMA | YEYNGKS. |
| PhylomeDB | Q9NQ66. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 2681. |
| Pathway_Interaction_DB | endothelinpathway. Endothelins. er_nongenomic_pathway. Plasma membrane estrogen receptor signaling. |
| Reactome | REACT_111102. Signal Transduction. REACT_111217. Metabolism. REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | Q9NQ66. |
| Bgee | Q9NQ66. |
| Genevestigator | Q9NQ66. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR001192. Pinositol_PLipase_C. IPR016280. PLC-beta. IPR014815. PLC-beta_C. IPR009535. PLC-beta_CS. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR015359. PLipase_C_EF-hand-like. IPR000909. PLipase_C_PInositol-sp_X_dom. IPR001711. PLipase_C_Pinositol-sp_Y. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 2 hits. |
| KO | K05858. |
| Pfam | PF00168. C2. 1 hit. PF06631. DUF1154. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. PF08703. PLC-beta_C. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 44882. |
| SOURCE | Search... |
Entry information
| Entry name | PLCB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQ66 Secondary accession number(s): D3DW12 Q9UM26 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with