Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

PLCB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei331PROSITE-ProRule annotation1
Active sitei378PROSITE-ProRule annotation1

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • calmodulin binding Source: BHF-UCL
  • enzyme binding Source: UniProtKB
  • GTPase activator activity Source: BHF-UCL
  • phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
  • phosphatidylinositol phospholipase C activity Source: AgBase
  • protein homodimerization activity Source: BHF-UCL
  • signal transducer activity Source: UniProtKB-KW

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BioCyciZFISH:HS11935-MONOMER.
BRENDAi3.1.4.11. 2681.
ReactomeiR-HSA-112043. PLC beta mediated events.
R-HSA-1855204. Synthesis of IP3 and IP4 in the cytosol.
R-HSA-399997. Acetylcholine regulates insulin secretion.
R-HSA-4086398. Ca2+ pathway.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-418217. G beta:gamma signalling through PLC beta.
R-HSA-434316. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
R-HSA-500657. Presynaptic function of Kainate receptors.
SignaLinkiQ9NQ66.
SIGNORiQ9NQ66.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-I
Short name:
PLC-I
Phospholipase C-beta-1
Short name:
PLC-beta-1
Gene namesi
Name:PLCB1
Synonyms:KIAA0581
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:15917. PLCB1.

Subcellular locationi

  • Nucleus membrane By similarity
  • Cytoplasm By similarity

  • Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • myelin sheath Source: Ensembl
  • nuclear chromatin Source: BHF-UCL
  • nuclear membrane Source: UniProtKB-SubCell
  • nuclear speck Source: BHF-UCL
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Involvement in diseasei

Epileptic encephalopathy, early infantile, 12 (EIEE12)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG.
See also OMIM:613722

Keywords - Diseasei

Epilepsy

Organism-specific databases

DisGeNETi23236.
MalaCardsiPLCB1.
MIMi613722. phenotype.
OpenTargetsiENSG00000182621.
Orphaneti293181. Malignant migrating partial seizures of infancy.
3451. West syndrome.
PharmGKBiPA33384.

Chemistry databases

ChEMBLiCHEMBL4034.

Polymorphism and mutation databases

DMDMi12643814.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000884861 – 12161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1Add BLAST1216

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei236PhosphoserineBy similarity1
Modified residuei417PhosphoserineBy similarity1
Modified residuei509PhosphothreonineBy similarity1
Modified residuei511PhosphoserineBy similarity1
Modified residuei582PhosphoserineBy similarity1
Modified residuei887Phosphoserine; by PKCBy similarity1
Modified residuei978PhosphoserineBy similarity1
Modified residuei987PhosphoserineBy similarity1
Modified residuei1199PhosphoserineBy similarity1
Modified residuei1200PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NQ66.
MaxQBiQ9NQ66.
PaxDbiQ9NQ66.
PeptideAtlasiQ9NQ66.
PRIDEiQ9NQ66.

PTM databases

iPTMnetiQ9NQ66.
PhosphoSitePlusiQ9NQ66.
SwissPalmiQ9NQ66.

Expressioni

Gene expression databases

BgeeiENSG00000182621.
ExpressionAtlasiQ9NQ66. baseline and differential.
GenevisibleiQ9NQ66. HS.

Organism-specific databases

HPAiCAB004275.
CAB005334.
HPA034743.
HPA057910.

Interactioni

Subunit structurei

Interacts with DGKQ.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CEP76Q8TAP63EBI-3396023,EBI-742887
CTBP1Q13363-23EBI-3396023,EBI-10171858
CTBP2P565453EBI-3396023,EBI-741533
CTBP2Q8IY443EBI-3396023,EBI-10171902
TFCP2Q128003EBI-3396023,EBI-717422

GO - Molecular functioni

  • calmodulin binding Source: BHF-UCL
  • enzyme binding Source: UniProtKB
  • protein homodimerization activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi116841. 16 interactors.
IntActiQ9NQ66. 6 interactors.
MINTiMINT-5005654.
STRINGi9606.ENSP00000338185.

Chemistry databases

BindingDBiQ9NQ66.

Structurei

3D structure databases

ProteinModelPortaliQ9NQ66.
SMRiQ9NQ66.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini316 – 467PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST152
Domaini540 – 656PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini663 – 761C2PROSITE-ProRule annotationAdd BLAST99

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0169. Eukaryota.
ENOG410XPSW. LUCA.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG053609.
InParanoidiQ9NQ66.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG091G00XL.
PhylomeDBiQ9NQ66.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_dom-like.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLC_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q9NQ66-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF
60 70 80 90 100
FFYWTDQNKE TELLDLSLVK DARCGRHAKA PKDPKLRELL DVGNIGRLEQ
110 120 130 140 150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA
160 170 180 190 200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND
210 220 230 240 250
SIPQEDFTPE VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN
260 270 280 290 300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NNSLARKGQI SVDGFMRYLS
310 320 330 340 350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR
360 370 380 390 400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF
410 420 430 440 450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV
460 470 480 490 500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSMFEPS
510 520 530 540 550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV
560 570 580 590 600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK
610 620 630 640 650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTMD LAMQINMGMY EYNGKSGYRL
660 670 680 690 700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD
710 720 730 740 750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP TLACLRIAVY
760 770 780 790 800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP
810 820 830 840 850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETPSE
860 870 880 890 900
APSEARTTPA ENGVNHTTTL TPKPPSQALH SQPAPGSVKA PAKTEDLIQS
910 920 930 940 950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTDLIKEHTT
960 970 980 990 1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSTI EQDLAALDAE
1010 1020 1030 1040 1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ
1060 1070 1080 1090 1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR
1110 1120 1130 1140 1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHKE IRQQILDEKP KLQVELEQEY
1160 1170 1180 1190 1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPLSLSSDP GKVNHKTPSS
1210
EELGGDIPGK EFDTPL
Length:1,216
Mass (Da):138,567
Last modified:October 1, 2000 - v1
Checksum:i6F4263D1A50C6FD1
GO
Isoform B (identifier: Q9NQ66-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQVELEQEYQ...IPGKEFDTPL → GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,703
Checksum:iB9DA88251A5769FB
GO

Sequence cautioni

The sequence BAA25507 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB14641 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1 – 34MAGAQ…KWDDD → MGSLQGIATKILIRILSDAL IRKETDLKS in AAF86613 (PubMed:10760467).CuratedAdd BLAST34
Sequence conflicti189L → M in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti203P → L in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti216L → F in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti221P → L in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti266L → P in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti309P → T in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti320Q → R in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti352V → A in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti366K → R in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti393E → K in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti983P → S in CAB98143 (PubMed:11118617).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050541854E → K.Corresponds to variant rs2076413dbSNPEnsembl.1
Natural variantiVAR_036547907A → P in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0047181142 – 1216LQVEL…FDTPL → GEGSSSFLSETCHEDPSVSP NFTPPNPQALKW in isoform B. 4 PublicationsAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278313 mRNA. Translation: CAB98142.1.
AJ278314 mRNA. Translation: CAB98143.1.
AY004175 mRNA. Translation: AAF86613.1.
AB011153 mRNA. Translation: BAA25507.3. Different initiation.
AL031683
, AL034551, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI43121.1.
AL031683
, AL034551, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI43122.1.
AL034551
, AL031683, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI21973.1.
AL034551
, AL031683, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI21974.1.
AL049593
, AL031683, AL034551, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI22175.1.
AL049632
, AL031683, AL034551, AL049593, AL050315, AL050323 Genomic DNA. Translation: CAI43151.1.
AL049632
, AL031683, AL034551, AL050315, AL050323 Genomic DNA. Translation: CAI43152.1.
AL050315
, AL031683, AL034551, AL049593, AL049632, AL050323 Genomic DNA. Translation: CAI42238.1.
AL050315
, AL031683, AL034551, AL049632, AL050323 Genomic DNA. Translation: CAI42239.1.
AL050323
, AL031683, AL034551, AL049593, AL049632, AL050315 Genomic DNA. Translation: CAI22830.1.
AL050323
, AL031683, AL034551, AL050315, AL049632 Genomic DNA. Translation: CAI22831.1.
CH471133 Genomic DNA. Translation: EAX10372.1.
CH471133 Genomic DNA. Translation: EAX10373.1.
CH471133 Genomic DNA. Translation: EAX10374.1.
CH471133 Genomic DNA. Translation: EAX10376.1.
BC069420 mRNA. Translation: AAH69420.1.
BC117231 mRNA. Translation: AAI17232.1.
AL137267 mRNA. Translation: CAB70666.1.
AK023689 mRNA. Translation: BAB14641.1. Different initiation.
CCDSiCCDS13102.1. [Q9NQ66-1]
CCDS13103.1. [Q9NQ66-2]
RefSeqiNP_056007.1. NM_015192.3. [Q9NQ66-1]
NP_877398.1. NM_182734.2. [Q9NQ66-2]
UniGeneiHs.431173.

Genome annotation databases

EnsembliENST00000338037; ENSP00000338185; ENSG00000182621. [Q9NQ66-1]
ENST00000378637; ENSP00000367904; ENSG00000182621. [Q9NQ66-2]
ENST00000378641; ENSP00000367908; ENSG00000182621. [Q9NQ66-2]
GeneIDi23236.
KEGGihsa:23236.
UCSCiuc002wna.5. human. [Q9NQ66-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278313 mRNA. Translation: CAB98142.1.
AJ278314 mRNA. Translation: CAB98143.1.
AY004175 mRNA. Translation: AAF86613.1.
AB011153 mRNA. Translation: BAA25507.3. Different initiation.
AL031683
, AL034551, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI43121.1.
AL031683
, AL034551, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI43122.1.
AL034551
, AL031683, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI21973.1.
AL034551
, AL031683, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI21974.1.
AL049593
, AL031683, AL034551, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI22175.1.
AL049632
, AL031683, AL034551, AL049593, AL050315, AL050323 Genomic DNA. Translation: CAI43151.1.
AL049632
, AL031683, AL034551, AL050315, AL050323 Genomic DNA. Translation: CAI43152.1.
AL050315
, AL031683, AL034551, AL049593, AL049632, AL050323 Genomic DNA. Translation: CAI42238.1.
AL050315
, AL031683, AL034551, AL049632, AL050323 Genomic DNA. Translation: CAI42239.1.
AL050323
, AL031683, AL034551, AL049593, AL049632, AL050315 Genomic DNA. Translation: CAI22830.1.
AL050323
, AL031683, AL034551, AL050315, AL049632 Genomic DNA. Translation: CAI22831.1.
CH471133 Genomic DNA. Translation: EAX10372.1.
CH471133 Genomic DNA. Translation: EAX10373.1.
CH471133 Genomic DNA. Translation: EAX10374.1.
CH471133 Genomic DNA. Translation: EAX10376.1.
BC069420 mRNA. Translation: AAH69420.1.
BC117231 mRNA. Translation: AAI17232.1.
AL137267 mRNA. Translation: CAB70666.1.
AK023689 mRNA. Translation: BAB14641.1. Different initiation.
CCDSiCCDS13102.1. [Q9NQ66-1]
CCDS13103.1. [Q9NQ66-2]
RefSeqiNP_056007.1. NM_015192.3. [Q9NQ66-1]
NP_877398.1. NM_182734.2. [Q9NQ66-2]
UniGeneiHs.431173.

3D structure databases

ProteinModelPortaliQ9NQ66.
SMRiQ9NQ66.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116841. 16 interactors.
IntActiQ9NQ66. 6 interactors.
MINTiMINT-5005654.
STRINGi9606.ENSP00000338185.

Chemistry databases

BindingDBiQ9NQ66.
ChEMBLiCHEMBL4034.

PTM databases

iPTMnetiQ9NQ66.
PhosphoSitePlusiQ9NQ66.
SwissPalmiQ9NQ66.

Polymorphism and mutation databases

DMDMi12643814.

Proteomic databases

EPDiQ9NQ66.
MaxQBiQ9NQ66.
PaxDbiQ9NQ66.
PeptideAtlasiQ9NQ66.
PRIDEiQ9NQ66.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338037; ENSP00000338185; ENSG00000182621. [Q9NQ66-1]
ENST00000378637; ENSP00000367904; ENSG00000182621. [Q9NQ66-2]
ENST00000378641; ENSP00000367908; ENSG00000182621. [Q9NQ66-2]
GeneIDi23236.
KEGGihsa:23236.
UCSCiuc002wna.5. human. [Q9NQ66-1]

Organism-specific databases

CTDi23236.
DisGeNETi23236.
GeneCardsiPLCB1.
HGNCiHGNC:15917. PLCB1.
HPAiCAB004275.
CAB005334.
HPA034743.
HPA057910.
MalaCardsiPLCB1.
MIMi607120. gene.
613722. phenotype.
neXtProtiNX_Q9NQ66.
OpenTargetsiENSG00000182621.
Orphaneti293181. Malignant migrating partial seizures of infancy.
3451. West syndrome.
PharmGKBiPA33384.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0169. Eukaryota.
ENOG410XPSW. LUCA.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG053609.
InParanoidiQ9NQ66.
KOiK05858.
OMAiMMDFINL.
OrthoDBiEOG091G00XL.
PhylomeDBiQ9NQ66.
TreeFamiTF313216.

Enzyme and pathway databases

BioCyciZFISH:HS11935-MONOMER.
BRENDAi3.1.4.11. 2681.
ReactomeiR-HSA-112043. PLC beta mediated events.
R-HSA-1855204. Synthesis of IP3 and IP4 in the cytosol.
R-HSA-399997. Acetylcholine regulates insulin secretion.
R-HSA-4086398. Ca2+ pathway.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-418217. G beta:gamma signalling through PLC beta.
R-HSA-434316. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
R-HSA-500657. Presynaptic function of Kainate receptors.
SignaLinkiQ9NQ66.
SIGNORiQ9NQ66.

Miscellaneous databases

ChiTaRSiPLCB1. human.
GeneWikiiPLCB1.
GenomeRNAii23236.
PROiQ9NQ66.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182621.
ExpressionAtlasiQ9NQ66. baseline and differential.
GenevisibleiQ9NQ66. HS.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_dom-like.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR028400. PLC-beta1.
IPR014815. PLC-beta_C.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLC_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF12. PTHR10336:SF12. 1 hit.
PfamiPF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
PF08703. PLC-beta_C. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLCB1_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ66
Secondary accession number(s): D3DW12
, D3DW13, O60325, Q17RQ6, Q5TFF7, Q5TGC9, Q8IV93, Q9BQW2, Q9H4H2, Q9H8H5, Q9NQ65, Q9NQH9, Q9NTH4, Q9UJP6, Q9UM26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 173 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.