Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NQ66

- PLCB1_HUMAN

UniProt

Q9NQ66 - PLCB1_HUMAN

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

PLCB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei331 – 3311PROSITE-ProRule annotation
    Active sitei378 – 3781PROSITE-ProRule annotation

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. calmodulin binding Source: BHF-UCL
    3. enzyme binding Source: UniProtKB
    4. GTPase activator activity Source: BHF-UCL
    5. phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
    6. phosphatidylinositol phospholipase C activity Source: UniProtKB
    7. protein homodimerization activity Source: BHF-UCL
    8. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. activation of meiosis involved in egg activation Source: BHF-UCL
    2. cerebral cortex development Source: BHF-UCL
    3. fat cell differentiation Source: Ensembl
    4. G2/M transition of mitotic cell cycle Source: BHF-UCL
    5. glutamate receptor signaling pathway Source: BHF-UCL
    6. G-protein coupled acetylcholine receptor signaling pathway Source: BHF-UCL
    7. inositol phosphate metabolic process Source: Reactome
    8. insulin-like growth factor receptor signaling pathway Source: BHF-UCL
    9. interleukin-12-mediated signaling pathway Source: BHF-UCL
    10. interleukin-15-mediated signaling pathway Source: BHF-UCL
    11. interleukin-1-mediated signaling pathway Source: BHF-UCL
    12. intracellular signal transduction Source: InterPro
    13. lipid catabolic process Source: UniProtKB-KW
    14. memory Source: BHF-UCL
    15. negative regulation of monocyte extravasation Source: BHF-UCL
    16. negative regulation of transcription, DNA-templated Source: BHF-UCL
    17. phosphatidylinositol metabolic process Source: BHF-UCL
    18. positive regulation of acrosome reaction Source: BHF-UCL
    19. positive regulation of CD24 biosynthetic process Source: BHF-UCL
    20. positive regulation of developmental growth Source: BHF-UCL
    21. positive regulation of embryonic development Source: BHF-UCL
    22. positive regulation of G1/S transition of mitotic cell cycle Source: BHF-UCL
    23. positive regulation of GTPase activity Source: GOC
    24. positive regulation of interleukin-12 production Source: BHF-UCL
    25. positive regulation of JNK cascade Source: BHF-UCL
    26. positive regulation of myoblast differentiation Source: BHF-UCL
    27. positive regulation of transcription, DNA-templated Source: BHF-UCL
    28. regulation of fertilization Source: BHF-UCL
    29. regulation of G-protein coupled receptor protein signaling pathway Source: BHF-UCL
    30. signal transduction Source: UniProtKB
    31. small molecule metabolic process Source: Reactome
    32. synaptic transmission Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    BRENDAi3.1.4.11. 2681.
    ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.
    REACT_15426. PLC beta mediated events.
    REACT_172761. Ca2+ pathway.
    REACT_18283. G alpha (q) signalling events.
    REACT_18405. Acetylcholine regulates insulin secretion.
    REACT_19145. G beta:gamma signalling through PLC beta.
    REACT_19193. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
    REACT_21254. Presynaptic function of Kainate receptors.
    SignaLinkiQ9NQ66.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC:3.1.4.11)
    Alternative name(s):
    PLC-154
    Phosphoinositide phospholipase C-beta-1
    Phospholipase C-I
    Short name:
    PLC-I
    Phospholipase C-beta-1
    Short name:
    PLC-beta-1
    Gene namesi
    Name:PLCB1
    Synonyms:KIAA0581
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:15917. PLCB1.

    Subcellular locationi

    Nucleus membrane By similarity. Cytoplasm By similarity
    Note: Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytosol Source: Reactome
    3. extracellular vesicular exosome Source: UniProt
    4. nuclear chromatin Source: BHF-UCL
    5. nuclear membrane Source: UniProtKB-SubCell
    6. nuclear speck Source: BHF-UCL
    7. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Epileptic encephalopathy, early infantile, 12 (EIEE12) [MIM:613722]: A form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Keywords - Diseasei

    Epilepsy

    Organism-specific databases

    MIMi613722. phenotype.
    Orphaneti1934. Early infantile epileptic encephalopathy.
    293181. Malignant migrating partial seizures of infancy.
    PharmGKBiPA33384.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 121612161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1PRO_0000088486Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei887 – 8871Phosphoserine; by PKCBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9NQ66.
    PaxDbiQ9NQ66.
    PRIDEiQ9NQ66.

    PTM databases

    PhosphoSiteiQ9NQ66.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NQ66.
    BgeeiQ9NQ66.
    GenevestigatoriQ9NQ66.

    Organism-specific databases

    HPAiCAB004275.
    CAB005334.

    Interactioni

    Subunit structurei

    Interacts with DGKQ.1 Publication

    Protein-protein interaction databases

    BioGridi116841. 9 interactions.
    IntActiQ9NQ66. 1 interaction.
    MINTiMINT-5005654.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NQ66.
    SMRiQ9NQ66. Positions 11-830, 890-1170.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini316 – 467152PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini540 – 656117PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini663 – 76199C2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG149692.
    HOVERGENiHBG053609.
    InParanoidiQ9NQ66.
    KOiK05858.
    OMAiMMDFINL.
    OrthoDBiEOG7WDN1N.
    PhylomeDBiQ9NQ66.
    TreeFamiTF313216.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR028400. PLC-beta1.
    IPR014815. PLC-beta_C.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF12. PTHR10336:SF12. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    PF08703. PLC-beta_C. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000956. PLC-beta. 1 hit.
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEiPS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: Q9NQ66-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF     50
    FFYWTDQNKE TELLDLSLVK DARCGRHAKA PKDPKLRELL DVGNIGRLEQ 100
    RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA 150
    FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND 200
    SIPQEDFTPE VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN 250
    LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NNSLARKGQI SVDGFMRYLS 300
    GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR 350
    QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF 400
    KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV 450
    PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSMFEPS 500
    SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV 550
    KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK 600
    GTRVDSSNYM PQLFWNAGCQ MVALNFQTMD LAMQINMGMY EYNGKSGYRL 650
    KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD 700
    MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP TLACLRIAVY 750
    EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP 800
    DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETPSE 850
    APSEARTTPA ENGVNHTTTL TPKPPSQALH SQPAPGSVKA PAKTEDLIQS 900
    VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTDLIKEHTT 950
    KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSTI EQDLAALDAE 1000
    MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ 1050
    NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR 1100
    SYIQEVVQYI KRLEEAQSKR QEKLVEKHKE IRQQILDEKP KLQVELEQEY 1150
    QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPLSLSSDP GKVNHKTPSS 1200
    EELGGDIPGK EFDTPL 1216
    Length:1,216
    Mass (Da):138,567
    Last modified:October 1, 2000 - v1
    Checksum:i6F4263D1A50C6FD1
    GO
    Isoform B (identifier: Q9NQ66-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1142-1216: LQVELEQEYQ...IPGKEFDTPL → GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW

    Show »
    Length:1,173
    Mass (Da):133,703
    Checksum:iB9DA88251A5769FB
    GO

    Sequence cautioni

    The sequence BAA25507.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAB14641.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1 – 3434MAGAQ…KWDDD → MGSLQGIATKILIRILSDAL IRKETDLKS in AAF86613. (PubMed:10760467)CuratedAdd
    BLAST
    Sequence conflicti189 – 1891L → M in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti203 – 2031P → L in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti216 – 2161L → F in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti221 – 2211P → L in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti266 – 2661L → P in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti309 – 3091P → T in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti320 – 3201Q → R in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti352 – 3521V → A in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti366 – 3661K → R in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti393 – 3931E → K in AAF86613. (PubMed:10760467)Curated
    Sequence conflicti983 – 9831P → S in CAB98143. (PubMed:11118617)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti854 – 8541E → K.
    Corresponds to variant rs2076413 [ dbSNP | Ensembl ].
    VAR_050541
    Natural varianti907 – 9071A → P in a breast cancer sample; somatic mutation. 1 Publication
    VAR_036547

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1142 – 121675LQVEL…FDTPL → GEGSSSFLSETCHEDPSVSP NFTPPNPQALKW in isoform B. 4 PublicationsVSP_004718Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ278313 mRNA. Translation: CAB98142.1.
    AJ278314 mRNA. Translation: CAB98143.1.
    AY004175 mRNA. Translation: AAF86613.1.
    AB011153 mRNA. Translation: BAA25507.3. Different initiation.
    AL031683
    , AL034551, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI43121.1.
    AL031683
    , AL034551, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI43122.1.
    AL034551
    , AL031683, AL049593, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI21973.1.
    AL034551
    , AL031683, AL050315, AL049632, AL050323 Genomic DNA. Translation: CAI21974.1.
    AL049593
    , AL031683, AL034551, AL049632, AL050315, AL050323 Genomic DNA. Translation: CAI22175.1.
    AL049632
    , AL031683, AL034551, AL049593, AL050315, AL050323 Genomic DNA. Translation: CAI43151.1.
    AL049632
    , AL031683, AL034551, AL050315, AL050323 Genomic DNA. Translation: CAI43152.1.
    AL050315
    , AL031683, AL034551, AL049593, AL049632, AL050323 Genomic DNA. Translation: CAI42238.1.
    AL050315
    , AL031683, AL034551, AL049632, AL050323 Genomic DNA. Translation: CAI42239.1.
    AL050323
    , AL031683, AL034551, AL049593, AL049632, AL050315 Genomic DNA. Translation: CAI22830.1.
    AL050323
    , AL031683, AL034551, AL050315, AL049632 Genomic DNA. Translation: CAI22831.1.
    CH471133 Genomic DNA. Translation: EAX10372.1.
    CH471133 Genomic DNA. Translation: EAX10373.1.
    CH471133 Genomic DNA. Translation: EAX10374.1.
    CH471133 Genomic DNA. Translation: EAX10376.1.
    BC069420 mRNA. Translation: AAH69420.1.
    BC117231 mRNA. Translation: AAI17232.1.
    AL137267 mRNA. Translation: CAB70666.1.
    AK023689 mRNA. Translation: BAB14641.1. Different initiation.
    CCDSiCCDS13102.1. [Q9NQ66-1]
    CCDS13103.1. [Q9NQ66-2]
    RefSeqiNP_056007.1. NM_015192.3. [Q9NQ66-1]
    NP_877398.1. NM_182734.2. [Q9NQ66-2]
    XP_006723618.1. XM_006723555.1. [Q9NQ66-2]
    UniGeneiHs.431173.

    Genome annotation databases

    EnsembliENST00000338037; ENSP00000338185; ENSG00000182621. [Q9NQ66-1]
    ENST00000378637; ENSP00000367904; ENSG00000182621. [Q9NQ66-2]
    ENST00000378641; ENSP00000367908; ENSG00000182621. [Q9NQ66-2]
    GeneIDi23236.
    KEGGihsa:23236.
    UCSCiuc002wna.4. human. [Q9NQ66-2]
    uc002wnb.4. human. [Q9NQ66-1]

    Polymorphism databases

    DMDMi12643814.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ278313 mRNA. Translation: CAB98142.1 .
    AJ278314 mRNA. Translation: CAB98143.1 .
    AY004175 mRNA. Translation: AAF86613.1 .
    AB011153 mRNA. Translation: BAA25507.3 . Different initiation.
    AL031683
    , AL034551 , AL049593 , AL049632 , AL050315 , AL050323 Genomic DNA. Translation: CAI43121.1 .
    AL031683
    , AL034551 , AL050315 , AL049632 , AL050323 Genomic DNA. Translation: CAI43122.1 .
    AL034551
    , AL031683 , AL049593 , AL049632 , AL050315 , AL050323 Genomic DNA. Translation: CAI21973.1 .
    AL034551
    , AL031683 , AL050315 , AL049632 , AL050323 Genomic DNA. Translation: CAI21974.1 .
    AL049593
    , AL031683 , AL034551 , AL049632 , AL050315 , AL050323 Genomic DNA. Translation: CAI22175.1 .
    AL049632
    , AL031683 , AL034551 , AL049593 , AL050315 , AL050323 Genomic DNA. Translation: CAI43151.1 .
    AL049632
    , AL031683 , AL034551 , AL050315 , AL050323 Genomic DNA. Translation: CAI43152.1 .
    AL050315
    , AL031683 , AL034551 , AL049593 , AL049632 , AL050323 Genomic DNA. Translation: CAI42238.1 .
    AL050315
    , AL031683 , AL034551 , AL049632 , AL050323 Genomic DNA. Translation: CAI42239.1 .
    AL050323
    , AL031683 , AL034551 , AL049593 , AL049632 , AL050315 Genomic DNA. Translation: CAI22830.1 .
    AL050323
    , AL031683 , AL034551 , AL050315 , AL049632 Genomic DNA. Translation: CAI22831.1 .
    CH471133 Genomic DNA. Translation: EAX10372.1 .
    CH471133 Genomic DNA. Translation: EAX10373.1 .
    CH471133 Genomic DNA. Translation: EAX10374.1 .
    CH471133 Genomic DNA. Translation: EAX10376.1 .
    BC069420 mRNA. Translation: AAH69420.1 .
    BC117231 mRNA. Translation: AAI17232.1 .
    AL137267 mRNA. Translation: CAB70666.1 .
    AK023689 mRNA. Translation: BAB14641.1 . Different initiation.
    CCDSi CCDS13102.1. [Q9NQ66-1 ]
    CCDS13103.1. [Q9NQ66-2 ]
    RefSeqi NP_056007.1. NM_015192.3. [Q9NQ66-1 ]
    NP_877398.1. NM_182734.2. [Q9NQ66-2 ]
    XP_006723618.1. XM_006723555.1. [Q9NQ66-2 ]
    UniGenei Hs.431173.

    3D structure databases

    ProteinModelPortali Q9NQ66.
    SMRi Q9NQ66. Positions 11-830, 890-1170.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116841. 9 interactions.
    IntActi Q9NQ66. 1 interaction.
    MINTi MINT-5005654.

    Chemistry

    BindingDBi Q9NQ66.
    ChEMBLi CHEMBL4034.

    PTM databases

    PhosphoSitei Q9NQ66.

    Polymorphism databases

    DMDMi 12643814.

    Proteomic databases

    MaxQBi Q9NQ66.
    PaxDbi Q9NQ66.
    PRIDEi Q9NQ66.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338037 ; ENSP00000338185 ; ENSG00000182621 . [Q9NQ66-1 ]
    ENST00000378637 ; ENSP00000367904 ; ENSG00000182621 . [Q9NQ66-2 ]
    ENST00000378641 ; ENSP00000367908 ; ENSG00000182621 . [Q9NQ66-2 ]
    GeneIDi 23236.
    KEGGi hsa:23236.
    UCSCi uc002wna.4. human. [Q9NQ66-2 ]
    uc002wnb.4. human. [Q9NQ66-1 ]

    Organism-specific databases

    CTDi 23236.
    GeneCardsi GC20P008061.
    HGNCi HGNC:15917. PLCB1.
    HPAi CAB004275.
    CAB005334.
    MIMi 607120. gene.
    613722. phenotype.
    neXtProti NX_Q9NQ66.
    Orphaneti 1934. Early infantile epileptic encephalopathy.
    293181. Malignant migrating partial seizures of infancy.
    PharmGKBi PA33384.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149692.
    HOVERGENi HBG053609.
    InParanoidi Q9NQ66.
    KOi K05858.
    OMAi MMDFINL.
    OrthoDBi EOG7WDN1N.
    PhylomeDBi Q9NQ66.
    TreeFami TF313216.

    Enzyme and pathway databases

    BRENDAi 3.1.4.11. 2681.
    Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.
    REACT_15426. PLC beta mediated events.
    REACT_172761. Ca2+ pathway.
    REACT_18283. G alpha (q) signalling events.
    REACT_18405. Acetylcholine regulates insulin secretion.
    REACT_19145. G beta:gamma signalling through PLC beta.
    REACT_19193. Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion.
    REACT_21254. Presynaptic function of Kainate receptors.
    SignaLinki Q9NQ66.

    Miscellaneous databases

    ChiTaRSi PLCB1. human.
    GeneWikii PLCB1.
    GenomeRNAii 23236.
    NextBioi 44882.
    PROi Q9NQ66.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NQ66.
    Bgeei Q9NQ66.
    Genevestigatori Q9NQ66.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR028400. PLC-beta1.
    IPR014815. PLC-beta_C.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF12. PTHR10336:SF12. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    PF08703. PLC-beta_C. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000956. PLC-beta. 1 hit.
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEi PS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLCbeta1)."
      Caricasole A., Sala C., Roncarati R., Formenti E., Terstappen G.C.
      Biochim. Biophys. Acta 1517:63-72(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B).
      Tissue: Brain.
    2. "Identification and chromosomal localisation by fluorescence in situ hybridisation of human gene of phosphoinositide-specific phospholipase C beta 1."
      Peruzzi D., Calabrese G., Faenza I., Manzoli L., Matteucci A., Gianfrancesco F., Billi A.M., Stuppia L., Palka G., Cocco L.
      Biochim. Biophys. Acta 1484:175-182(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
      Tissue: Brain.
    3. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Tissue: Brain.
    4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    5. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
      Tissue: Brain.
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 261-1216 (ISOFORM B).
      Tissue: Testis.
    9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 417-1062 (ISOFORMS A AND B).
      Tissue: Placenta.
    10. Cited for: INTERACTION WITH DGKQ.
    11. Cited for: INVOLVEMENT IN EIEE12.
    12. Cited for: VARIANT [LARGE SCALE ANALYSIS] PRO-907.

    Entry informationi

    Entry nameiPLCB1_HUMAN
    AccessioniPrimary (citable) accession number: Q9NQ66
    Secondary accession number(s): D3DW12
    , D3DW13, O60325, Q17RQ6, Q5TFF7, Q5TGC9, Q8IV93, Q9BQW2, Q9H4H2, Q9H8H5, Q9NQ65, Q9NQH9, Q9NTH4, Q9UJP6, Q9UM26
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 151 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3