Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Equatorin

Gene

EQTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Acrosomal membrane-anchored protein involved in the process of fertilization and in acrosome biogenesis.By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Equatorin
Alternative name(s):
Acrosome formation-associated factor
Gene namesi
Name:EQTN
Synonyms:AFAF, C9orf11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:1359. EQTN.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini15 – 181167VesicularSequence analysisAdd
BLAST
Transmembranei182 – 20221HelicalSequence analysisAdd
BLAST
Topological domaini203 – 29492CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25969.

Polymorphism and mutation databases

BioMutaiEQTN.
DMDMi147742918.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1414Sequence analysisAdd
BLAST
Chaini15 – 294280EquatorinPRO_0000286593Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi76 – 761N-linked (GlcNAc...)Sequence analysis
Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

Highly N- and O-glycosylated; contains sialic acid.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9NQ60.
PRIDEiQ9NQ60.

PTM databases

iPTMnetiQ9NQ60.
PhosphoSiteiQ9NQ60.

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in testis. Isoform 2 is expressed at low levels in skin and blood.1 Publication

Gene expression databases

BgeeiQ9NQ60.
CleanExiHS_C9orf11.
GenevisibleiQ9NQ60. HS.

Organism-specific databases

HPAiHPA015089.
HPA015504.

Interactioni

Subunit structurei

Interacts with SNAP25.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000369371.

Structurei

3D structure databases

ProteinModelPortaliQ9NQ60.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IX0T. Eukaryota.
ENOG4111AZ5. LUCA.
GeneTreeiENSGT00390000010786.
HOGENOMiHOG000033836.
HOVERGENiHBG106628.
InParanoidiQ9NQ60.
KOiK19920.
OMAiQYVFTTQ.
OrthoDBiEOG7SJD5G.
PhylomeDBiQ9NQ60.
TreeFamiTF337449.

Family and domain databases

InterProiIPR029282. Eqtn/Afaf.
[Graphical view]
PfamiPF15339. Afaf. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NQ60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFILFIFIP GVFSLKSSTL KPTIEALPNV LPLNEDVNKQ EEKNEDHTPN
60 70 80 90 100
YAPANEKNGN YYKDIKQYVF TTQNPNGTES EISVRATTDL NFALKNDKTV
110 120 130 140 150
NATTYEKSTI EEETTTSEPS HKNIQRSTPN VPAFWTMLAK AINGTAVVMD
160 170 180 190 200
DKDQLFHPIP ESDVNATQGE NQPDLEDLKI KIMLGISLMT LLLFVVLLAF
210 220 230 240 250
CSATLYKLRH LSYKSCESQY SVNPELATMS YFHPSEGVSD TSFSKSAESS
260 270 280 290
TFLGTTSSDM RRSGTRTSES KIMTDIISIG SDNEMHENDE SVTR
Length:294
Mass (Da):32,840
Last modified:May 15, 2007 - v2
Checksum:i0EEB8BD5F22F4063
GO
Isoform 2 (identifier: Q9NQ60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-127: RS → SI
     128-294: Missing.

Show »
Length:127
Mass (Da):14,360
Checksum:i55DB058714124EDB
GO
Isoform 3 (identifier: Q9NQ60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-126: DKTVNATTYEKSTIEEETTTSEPSHKNIQR → G

Show »
Length:265
Mass (Da):29,476
Checksum:iA723653FC5307981
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti282 – 2821D → N in CAC00687 (PubMed:11118625).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti101 – 1011N → D.
Corresponds to variant rs12337286 [ dbSNP | Ensembl ].
VAR_032136
Natural varianti110 – 1101I → T.
Corresponds to variant rs12341576 [ dbSNP | Ensembl ].
VAR_056727
Natural varianti274 – 2741T → K.1 Publication
Corresponds to variant rs41305329 [ dbSNP | Ensembl ].
VAR_032137

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei97 – 12630DKTVN…KNIQR → G in isoform 3. 1 PublicationVSP_042157Add
BLAST
Alternative sequencei126 – 1272RS → SI in isoform 2. 1 PublicationVSP_025109
Alternative sequencei128 – 294167Missing in isoform 2. 1 PublicationVSP_025110Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278482 mRNA. Translation: CAC00687.1.
AL133411 Genomic DNA. Translation: CAD13444.1.
AL133411 Genomic DNA. Translation: CAI16056.1.
CH471071 Genomic DNA. Translation: EAW58566.1.
BC014307 mRNA. Translation: AAH14307.1.
BC137351 mRNA. Translation: AAI37352.1.
BC137352 mRNA. Translation: AAI37353.1.
BC144602 mRNA. Translation: AAI44603.1.
CCDSiCCDS35001.1. [Q9NQ60-1]
CCDS55300.1. [Q9NQ60-3]
RefSeqiNP_001155057.1. NM_001161585.1. [Q9NQ60-3]
NP_065692.2. NM_020641.2. [Q9NQ60-1]
UniGeneiHs.163070.

Genome annotation databases

EnsembliENST00000380031; ENSP00000369370; ENSG00000120160. [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160. [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160. [Q9NQ60-3]
GeneIDi54586.
KEGGihsa:54586.
UCSCiuc003zql.4. human. [Q9NQ60-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278482 mRNA. Translation: CAC00687.1.
AL133411 Genomic DNA. Translation: CAD13444.1.
AL133411 Genomic DNA. Translation: CAI16056.1.
CH471071 Genomic DNA. Translation: EAW58566.1.
BC014307 mRNA. Translation: AAH14307.1.
BC137351 mRNA. Translation: AAI37352.1.
BC137352 mRNA. Translation: AAI37353.1.
BC144602 mRNA. Translation: AAI44603.1.
CCDSiCCDS35001.1. [Q9NQ60-1]
CCDS55300.1. [Q9NQ60-3]
RefSeqiNP_001155057.1. NM_001161585.1. [Q9NQ60-3]
NP_065692.2. NM_020641.2. [Q9NQ60-1]
UniGeneiHs.163070.

3D structure databases

ProteinModelPortaliQ9NQ60.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000369371.

PTM databases

iPTMnetiQ9NQ60.
PhosphoSiteiQ9NQ60.

Polymorphism and mutation databases

BioMutaiEQTN.
DMDMi147742918.

Proteomic databases

PaxDbiQ9NQ60.
PRIDEiQ9NQ60.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380031; ENSP00000369370; ENSG00000120160. [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160. [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160. [Q9NQ60-3]
GeneIDi54586.
KEGGihsa:54586.
UCSCiuc003zql.4. human. [Q9NQ60-1]

Organism-specific databases

CTDi54586.
GeneCardsiEQTN.
H-InvDBHIX0007962.
HGNCiHGNC:1359. EQTN.
HPAiHPA015089.
HPA015504.
neXtProtiNX_Q9NQ60.
PharmGKBiPA25969.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IX0T. Eukaryota.
ENOG4111AZ5. LUCA.
GeneTreeiENSGT00390000010786.
HOGENOMiHOG000033836.
HOVERGENiHBG106628.
InParanoidiQ9NQ60.
KOiK19920.
OMAiQYVFTTQ.
OrthoDBiEOG7SJD5G.
PhylomeDBiQ9NQ60.
TreeFamiTF337449.

Miscellaneous databases

GenomeRNAii54586.
PROiQ9NQ60.

Gene expression databases

BgeeiQ9NQ60.
CleanExiHS_C9orf11.
GenevisibleiQ9NQ60. HS.

Family and domain databases

InterProiIPR029282. Eqtn/Afaf.
[Graphical view]
PfamiPF15339. Afaf. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterisation of a novel human gene (C9orf11) on chromosome 9p21, a region frequently deleted in human cancer."
    Ruiz A., Pujana M.A., Estivill X.
    Biochim. Biophys. Acta 1517:128-134(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT LYS-274.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Testis.

Entry informationi

Entry nameiEQTN_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ60
Secondary accession number(s): B2RPB3
, B7ZMK1, Q5TCU1, Q96L22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: June 8, 2016
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.