Q9NQ38 (ISK5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine protease inhibitor Kazal-type 5 Alternative name(s): Lympho-epithelial Kazal-type-related inhibitor Short name=LEKTI Cleaved into the following 2 chains: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1064 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine protease inhibitor, probably important for the anti-inflammatory and/or antimicrobial protection of mucous epithelia. Contribute to the integrity and protective barrier function of the skin by regulating the activity of defense-activating and desquamation-involved proteases. Inhibits KLK5, it's major target, in a pH-dependent manner. Inhibits KLK7, KLK14 CASP14, and trypsin. Ref.1 Ref.7 Ref.8 |
| Subcellular location | |
| Tissue specificity | Highly expressed in the thymus and stratum corneum. Also found in the oral mucosa, parathyroid gland, Bartholin's glands, tonsils, and vaginal epithelium. Very low levels are detected in lung, kidney, and prostate. Ref.1 |
| Domain | Contains at least one active inhibitory domain for trypsin (domain 6). |
| Post-translational modification | Proteolytically processed by furin in individual domains (D1, D5, D6, D8 through D11, and D9 through D15) exhibiting various inhibitory potentials for multiple proteases. |
| Involvement in disease | Netherton syndrome (NETH) [MIM:256500]: An autosomal recessive congenital ichthyosis associated with hair shaft abnormalities and anomalies of the immune system. Typical features are ichthyosis linearis circumflexa, ichthyosiform erythroderma, trichorrhexis invaginata (bamboo hair), atopic dermatitis, and hayfever. High postnatal mortality is due to failure to thrive, infections and hypernatremic dehydration. |
| Sequence similarities | Contains 15 Kazal-like domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform f-l (identifier: Q9NQ38-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform short (identifier: Q9NQ38-2) The sequence of this isoform differs from the canonical sequence as follows: 914-916: DEC → VIY 917-1064: Missing. | ||||||
| Isoform long (identifier: Q9NQ38-3) The sequence of this isoform differs from the canonical sequence as follows: 914-914: D → DQCRQVQNEAEDAKFRQPGRSLASVARMSTD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||||||||||||||||||||||||||||||||
| Chain | 23 – 1064 | 1042 | Serine protease inhibitor Kazal-type 5 | PRO_0000016572 | |||||||||||||||||||||||||||||||||||||
| Peptide | 23 – 77 | 55 | Hemofiltrate peptide HF6478 | PRO_0000016573 | |||||||||||||||||||||||||||||||||||||
| Peptide | 356 – 423 | 68 | Hemofiltrate peptide HF7665 | PRO_0000016574 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 28 – 66 | 39 | Kazal-like 1; atypical | ||||||||||||||||||||||||||||||||||||||
| Domain | 91 – 153 | 63 | Kazal-like 2 | ||||||||||||||||||||||||||||||||||||||
| Domain | 155 – 216 | 62 | Kazal-like 3 | ||||||||||||||||||||||||||||||||||||||
| Domain | 219 – 285 | 67 | Kazal-like 4 | ||||||||||||||||||||||||||||||||||||||
| Domain | 291 – 352 | 62 | Kazal-like 5 | ||||||||||||||||||||||||||||||||||||||
| Domain | 361 – 423 | 63 | Kazal-like 6 | ||||||||||||||||||||||||||||||||||||||
| Domain | 431 – 489 | 59 | Kazal-like 7 | ||||||||||||||||||||||||||||||||||||||
| Domain | 490 – 551 | 62 | Kazal-like 8 | ||||||||||||||||||||||||||||||||||||||
| Domain | 561 – 622 | 62 | Kazal-like 9 | ||||||||||||||||||||||||||||||||||||||
| Domain | 626 – 688 | 63 | Kazal-like 10 | ||||||||||||||||||||||||||||||||||||||
| Domain | 701 – 757 | 57 | Kazal-like 11 | ||||||||||||||||||||||||||||||||||||||
| Domain | 768 – 830 | 63 | Kazal-like 12 | ||||||||||||||||||||||||||||||||||||||
| Domain | 843 – 905 | 63 | Kazal-like 13 | ||||||||||||||||||||||||||||||||||||||
| Domain | 910 – 971 | 62 | Kazal-like 14 | ||||||||||||||||||||||||||||||||||||||
| Domain | 987 – 1048 | 62 | Kazal-like 15 | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Site | 46 – 47 | 2 | Reactive bond Potential | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 30 ↔ 66 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 44 ↔ 63 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 97 ↔ 133 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 111 ↔ 130 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 119 ↔ 151 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 161 ↔ 197 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 175 ↔ 194 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 225 ↔ 261 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 239 ↔ 258 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 297 ↔ 333 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 311 ↔ 330 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 367 ↔ 403 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 381 ↔ 400 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 437 ↔ 473 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 451 ↔ 470 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 496 ↔ 532 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 510 ↔ 529 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 567 ↔ 603 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 581 ↔ 600 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 632 ↔ 668 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 646 ↔ 665 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 707 ↔ 743 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 721 ↔ 740 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 774 ↔ 810 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 788 ↔ 807 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 849 ↔ 885 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 863 ↔ 882 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 916 ↔ 952 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 930 ↔ 949 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 993 ↔ 1028 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1006 ↔ 1025 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1014 ↔ 1046 | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 914 – 916 | 3 | DEC → VIY in isoform short. | VSP_040019 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 914 | 1 | D → DQCRQVQNEAEDAKFRQPGR SLASVARMSTD in isoform long. | VSP_040020 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 917 – 1064 | 148 | Missing in isoform short. | VSP_040021 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Corresponds to variant rs6892205 [ dbSNP | Ensembl ]. | VAR_047115 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 335 | 1 | A → V. Ref.1 Ref.3 Corresponds to variant rs34482796 [ dbSNP | Ensembl ]. | VAR_061337 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 368 | 1 | S → N. Ref.1 Ref.2 Ref.3 Corresponds to variant rs2303063 [ dbSNP | Ensembl ]. | VAR_047116 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 386 | 1 | D → N. Corresponds to variant rs2303064 [ dbSNP | Ensembl ]. | VAR_047117 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 395 | 1 | V → M. Corresponds to variant rs17775319 [ dbSNP | Ensembl ]. | VAR_047118 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 420 | 1 | K → E. Ref.1 Ref.3 Ref.11 Corresponds to variant rs2303067 [ dbSNP | Ensembl ]. | VAR_015537 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 441 | 1 | R → H. Corresponds to variant rs34393923 [ dbSNP | Ensembl ]. | VAR_047119 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 588 | 1 | I → M. Corresponds to variant rs35877540 [ dbSNP | Ensembl ]. | VAR_047120 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 711 | 1 | R → Q. Ref.1 Ref.3 Corresponds to variant rs3777134 [ dbSNP | Ensembl ]. | VAR_047121 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 825 | 1 | E → D. Corresponds to variant rs2303070 [ dbSNP | Ensembl ]. | VAR_047122 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 887 | 1 | S → R. Corresponds to variant rs28408445 [ dbSNP | Ensembl ]. | VAR_047123 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 969 | 1 | K → E. Corresponds to variant rs3188691 [ dbSNP | Ensembl ]. | VAR_047124 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 972 | 1 | H → R. Corresponds to variant rs17705005 [ dbSNP | Ensembl ]. | VAR_047125 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 19 – 27 | 9 | DAASKNEDQ → GQCEKDSLS in CAB96877. Ref.2 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Turn | 25 – 27 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 33 – 36 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 37 – 40 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 48 – 52 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 54 – 76 | 23 | |||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 366 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 367 – 370 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 371 – 373 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 375 – 377 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 399 – 413 | 15 | |||||||||||||||||||||||||||||||||||||||
| Helix | 990 – 993 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 1000 – 1002 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 1013 – 1015 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 1016 – 1018 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 1019 – 1024 | 6 | |||||||||||||||||||||||||||||||||||||||
| Helix | 1025 – 1034 | 10 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 1040 – 1045 | 6 | |||||||||||||||||||||||||||||||||||||||
| Helix | 1047 – 1049 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 1055 – 1058 | 4 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "LEKTI, a novel 15-domain type of human serine proteinase inhibitor." Maegert H.-J., Staendker L., Kreutzmann P., Zucht H.-D., Reinecke M., Sommerhoff C.P., Fritz H., Forssmann W.-G. J. Biol. Chem. 274:21499-21502(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS F-L), PARTIAL PROTEIN SEQUENCE, VARIANTS ARG-267; VAL-335; ASN-368; GLU-420 AND GLN-711, FUNCTION, TISSUE SPECIFICITY. Tissue: Epithelium. |
| [2] | "Mutations in SPINK5, encoding a serine protease inhibitor, cause Netherton syndrome." Chavanas S., Bodemer C., Rochat A., Hamel-Teillac D., Ali M., Irvine A.D., Bonafe J.-L., Wilkinson J., Taieb A., Barrandon Y., Harper J.I., de Prost Y., Hovnanian A. Nat. Genet. 25:141-142(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INVOLVEMENT IN NETHERTON SYNDROME, VARIANTS ARG-267 AND ASN-368. |
| [3] | "SPINK5, the defective gene in netherton syndrome, encodes multiple LEKTI isoforms derived from alternative pre-mRNA processing." Tartaglia-Polcini A., Bonnart C., Micheloni A., Cianfarani F., Andre A., Zambruno G., Hovnanian A., D'Alessio M. J. Invest. Dermatol. 126:315-324(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT; F-L AND LONG), ALTERNATIVE SPLICING, VARIANTS ARG-267; VAL-335; ASN-368; GLU-420 AND GLN-711. Tissue: Keratinocyte. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The spectrum of pathogenic mutations in SPINK5 in 19 families with Netherton syndrome: implications for mutation detection and first case of prenatal diagnosis." Sprecher E., Chavanas S., DiGiovanna J.J., Amin S., Nielsen K., Prendiville J.S., Silverman R., Esterly N.B., Spraker M.K., Guelig E., de Luna M.L., Williams M.L., Buehler B., Siegfried E.C., Van Maldergem L., Pfendner E., Bale S.J., Uitto J., Hovnanian A., Richard G. J. Invest. Dermatol. 117:179-187(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 202-222 AND 266-294. |
| [6] | "Purification and partial amino acid sequence of proteins from human epidermal keratinocyte conditioned medium." Ahmed A., Kandola P., Ziada G., Parenteau N. J. Protein Chem. 20:273-278(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 490-507. Tissue: Foreskin keratinocyte. |
| [7] | "LEKTI fragments specifically inhibit KLK5, KLK7, and KLK14 and control desquamation through a pH-dependent interaction." Deraison C., Bonnart C., Lopez F., Besson C., Robinson R., Jayakumar A., Wagberg F., Brattsand M., Hachem J.P., Leonardsson G., Hovnanian A. Mol. Biol. Cell 18:3607-3619(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CLEAVAGE BY FURIN, INHIBITION OF KLK5; KLK7 AND KLK14. |
| [8] | "New role for LEKTI in skin barrier formation: label-free quantitative proteomic identification of caspase 14 as a novel target for the protease inhibitor LEKTI." Bennett K., Callard R., Heywood W., Harper J., Jayakumar A., Clayman G.L., Di W.L., Mills K. J. Proteome Res. 9:4289-4294(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INHIBITION OF CASP14. |
| [9] | "Homologous proteins with different folds: the three-dimensional structures of domains 1 and 6 of the multiple Kazal-type inhibitor LEKTI." Lauber T., Schulz A., Schweimer K., Adermann K., Marx U.C. J. Mol. Biol. 328:205-219(2003) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 23-77 AND 356-423. |
| [10] | "The solution structure of a chimeric LEKTI domain reveals a chameleon sequence." Tidow H., Lauber T., Vitzithum K., Sommerhoff C.P., Rosch P., Marx U.C. Biochemistry 43:11238-11247(2004) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 989-1064. |
| [11] | "Gene polymorphism in Netherton and common atopic disease." Walley A.J., Chavanas S., Moffatt M.F., Esnouf R.M., Ubhi B., Lawrence R., Wong K., Abecasis G.R., Jones E.Y., Harper J.I., Hovnanian A., Cookson W.O.C.M. Nat. Genet. 29:175-178(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLU-420. |
| + | Additional computationally mapped references. |
Web resources
| SPINK5base SPINK5 mutation db |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ228139 mRNA. Translation: CAB40839.1. AJ391230 AJ276577 Genomic DNA. Translation: CAB96877.1.DQ149927 mRNA. Translation: ABA06534.1. DQ149928 mRNA. Translation: ABA06535.1. DQ149929 mRNA. Translation: ABA06536.1. AC008722 Genomic DNA. No translation available. AC116334 Genomic DNA. No translation available. AF295784 Genomic DNA. Translation: AAK97139.1. AF295783 Genomic DNA. Translation: AAK97140.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00478816. IPI00654656. IPI00936431. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001121170.1. NM_001127698.1. NP_001121171.1. NM_001127699.1. NP_006837.2. NM_006846.3. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.331555. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000352936. | ||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||
| MEROPS | I01.013. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 212276440. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 11005. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000256084; ENSP00000256084; ENSG00000133710. ENST00000359874; ENSP00000352936; ENSG00000133710. ENST00000398454; ENSP00000381472; ENSG00000133710. | ||||||||||||||||||||||||||||||||||||
| GeneID | 11005. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:11005. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc003low.2. human. uc003lox.2. human. uc003loy.2. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 11005. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC05P147423. | ||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0005288. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:15464. SPINK5. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB015347. HPA009067. HPA011351. | ||||||||||||||||||||||||||||||||||||
| MIM | 256500. phenotype. 605010. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 634. Netherton syndrome. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37962. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG253835. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG006183. | ||||||||||||||||||||||||||||||||||||
| OMA | NGKLICT. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4V4371. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SPINK5. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000133710. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR002350. Kazal_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00050. Kazal_1. 1 hit. PF07648. Kazal_2. 13 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00280. KAZAL. 14 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS00282. KAZAL_1. 2 hits. PS51465. KAZAL_2. 14 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 11005. | ||||||||||||||||||||||||||||||||||||
| NextBio | 41803. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q9NQ38. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ISK5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NQ38 Secondary accession number(s): A8MYE8 Q96PP3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
