Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal peptide, CUB and EGF-like domain-containing protein 2

Gene

SCUBE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiR-HSA-5362798. Release of Hh-Np from the secreting cell.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal peptide, CUB and EGF-like domain-containing protein 2
Alternative name(s):
Protein CEGP1
Gene namesi
Name:SCUBE2
Synonyms:CEGP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:30425. SCUBE2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134908812.

Polymorphism and mutation databases

BioMutaiSCUBE2.
DMDMi311033510.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131Sequence analysisAdd
BLAST
Chaini32 – 999968Signal peptide, CUB and EGF-like domain-containing protein 2PRO_0000255580Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi49 ↔ 62By similarity
Disulfide bondi56 ↔ 71By similarity
Disulfide bondi73 ↔ 84By similarity
Disulfide bondi90 ↔ 102By similarity
Disulfide bondi98 ↔ 111By similarity
Disulfide bondi113 ↔ 126By similarity
Disulfide bondi368 ↔ 378By similarity
Disulfide bondi374 ↔ 387By similarity
Disulfide bondi389 ↔ 401By similarity
Disulfide bondi407 ↔ 418By similarity
Disulfide bondi414 ↔ 427By similarity
Disulfide bondi429 ↔ 442By similarity
Glycosylationi659 – 6591N-linked (GlcNAc...)Sequence analysis
Disulfide bondi809 ↔ 835By similarity
Disulfide bondi862 ↔ 883By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ9NQ36.

PTM databases

iPTMnetiQ9NQ36.
PhosphoSiteiQ9NQ36.

Expressioni

Tissue specificityi

Expressed in a broad spectrum of adult tissues.1 Publication

Gene expression databases

BgeeiQ9NQ36.
CleanExiHS_SCUBE2.
ExpressionAtlasiQ9NQ36. baseline and differential.
GenevisibleiQ9NQ36. HS.

Organism-specific databases

HPAiHPA006353.
HPA029871.

Interactioni

Subunit structurei

Forms homooligomers and heterooligomers with SCUBE1 and SCUBE3.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ9NQ36.
SMRiQ9NQ36. Positions 45-213, 228-441, 809-918.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 8541EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini86 – 12742EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini128 – 16841EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini177 – 21337EGF-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini217 – 25236EGF-like 5PROSITE-ProRule annotationAdd
BLAST
Domaini286 – 32136EGF-like 6PROSITE-ProRule annotationAdd
BLAST
Domaini323 – 36341EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini364 – 40239EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini403 – 44341EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini809 – 921113CUBPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 CUB domain.PROSITE-ProRule annotation
Contains 9 EGF-like domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

HOGENOMiHOG000230943.
HOVERGENiHBG054902.
InParanoidiQ9NQ36.
OrthoDBiEOG7P8P71.
PhylomeDBiQ9NQ36.
TreeFamiTF351672.

Family and domain databases

Gene3Di2.60.120.290. 1 hit.
InterProiIPR026823. cEGF.
IPR000859. CUB_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom.
IPR009030. Growth_fac_rcpt_.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view]
PfamiPF12662. cEGF. 1 hit.
PF00431. CUB. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07699. Ephrin_rec_like. 3 hits.
[Graphical view]
SMARTiSM00042. CUB. 1 hit.
SM00181. EGF. 10 hits.
SM00179. EGF_CA. 8 hits.
SM01411. Ephrin_rec_like. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 1 hit.
SSF57184. SSF57184. 4 hits.
PROSITEiPS00010. ASX_HYDROXYL. 6 hits.
PS01180. CUB. 1 hit.
PS01186. EGF_2. 8 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 6 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NQ36-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGVAGRNRPG AAWAVLLLLL LLPPLLLLAG AVPPGRGRAA GPQEDVDECA
60 70 80 90 100
QGLDDCHADA LCQNTPTSYK CSCKPGYQGE GRQCEDIDEC GNELNGGCVH
110 120 130 140 150
DCLNIPGNYR CTCFDGFMLA HDGHNCLDVD ECLENNGGCQ HTCVNVMGSY
160 170 180 190 200
ECCCKEGFFL SDNQHTCIHR SEEGLSCMNK DHGCSHICKE APRGSVACEC
210 220 230 240 250
RPGFELAKNQ RDCILTCNHG NGGCQHSCDD TADGPECSCH PQYKMHTDGR
260 270 280 290 300
SCLEREDTVL EVTESNTTSV VDGDKRVKRR LLMETCAVNN GGCDRTCKDT
310 320 330 340 350
STGVHCSCPV GFTLQLDGKT CKDIDECQTR NGGCDHFCKN IVGSFDCGCK
360 370 380 390 400
KGFKLLTDEK SCQDVDECSL DRTCDHSCIN HPGTFACACN RGYTLYGFTH
410 420 430 440 450
CGDTNECSIN NGGCQQVCVN TVGSYECQCH PGYKLHWNKK DCVEVKGLLP
460 470 480 490 500
TSVSPRVSLH CGKSGGGDGC FLRCHSGIHL SSDVTTIRTS VTFKLNEGKC
510 520 530 540 550
SLKNAELFPE GLRPALPEKH SSVKESFRYV NLTCSSGKQV PGAPGRPSTP
560 570 580 590 600
KEMFITVEFE LETNQKEVTA SCDLSCIVKR TEKRLRKAIR TLRKAVHREQ
610 620 630 640 650
FHLQLSGMNL DVAKKPPRTS ERQAESCGVG QGHAENQCVS CRAGTYYDGA
660 670 680 690 700
RERCILCPNG TFQNEEGQMT CEPCPRPGNS GALKTPEAWN MSECGGLCQP
710 720 730 740 750
GEYSADGFAP CHLCALGTFQ PEAGRTSCFP CGGGLATKHQ GATSFQDCET
760 770 780 790 800
RVQCSPGHFY NTTTHRCIRC PVGTYQPEFG KNNCVSCPGN TTTDFDGSTN
810 820 830 840 850
ITQCKNRRCG GELGDFTGYI ESPNYPGNYP ANTECTWTIN PPPKRRILIV
860 870 880 890 900
VPEIFLPIED DCGDYLVMRK TSSSNSVTTY ETCQTYERPI AFTSRSKKLW
910 920 930 940 950
IQFKSNEGNS ARGFQVPYVT YDEDYQELIE DIVRDGRLYA SENHQEILKD
960 970 980 990
KKLIKALFDV LAHPQNYFKY TAQESREMFP RSFIRLLRSK VSRFLRPYK
Length:999
Mass (Da):109,966
Last modified:November 2, 2010 - v2
Checksum:i1EE1B0BC2D5DED93
GO
Isoform 2 (identifier: Q9NQ36-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     482-482: S → SGLQGAYSVTCGSSSPLRNKQQKSNDSAFG
     639-695: Missing.

Show »
Length:971
Mass (Da):106,766
Checksum:iDF62C02052F0E0F0
GO
Isoform 3 (identifier: Q9NQ36-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     444-569: Missing.
     806-872: NRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTS → T

Show »
Length:807
Mass (Da):88,879
Checksum:i8D8CFF8E9D525120
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti916 – 9161V → G in BAC85521 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti591 – 5911T → M.1 Publication
Corresponds to variant rs3751055 [ dbSNP | Ensembl ].
VAR_028870
Natural varianti712 – 7121H → Q.3 Publications
Corresponds to variant rs7395988 [ dbSNP | Ensembl ].
VAR_028871
Natural varianti752 – 7521V → G.
Corresponds to variant rs12419343 [ dbSNP | Ensembl ].
VAR_028872
Natural varianti791 – 7911T → S.
Corresponds to variant rs3751057 [ dbSNP | Ensembl ].
VAR_028873
Natural varianti843 – 8431P → R.
Corresponds to variant rs3751059 [ dbSNP | Ensembl ].
VAR_028874

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei444 – 569126Missing in isoform 3. 1 PublicationVSP_021293Add
BLAST
Alternative sequencei482 – 4821S → SGLQGAYSVTCGSSSPLRNK QQKSNDSAFG in isoform 2. 1 PublicationVSP_021294
Alternative sequencei639 – 69557Missing in isoform 2. 1 PublicationVSP_039955Add
BLAST
Alternative sequencei806 – 87267NRRCG…MRKTS → T in isoform 3. 1 PublicationVSP_021295Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA. Translation: CAB92285.1.
AK123039 mRNA. Translation: BAC85521.1.
AC079296 Genomic DNA. No translation available.
BC111690 mRNA. Translation: AAI11691.1.
CCDSiCCDS53599.1. [Q9NQ36-3]
CCDS7797.2. [Q9NQ36-2]
RefSeqiNP_001164161.1. NM_001170690.1.
NP_066025.2. NM_020974.2.
XP_005253090.2. XM_005253033.3.
UniGeneiHs.523468.

Genome annotation databases

EnsembliENST00000309263; ENSP00000310658; ENSG00000175356.
ENST00000450649; ENSP00000415187; ENSG00000175356.
GeneIDi57758.
KEGGihsa:57758.
UCSCiuc001mhj.3. human. [Q9NQ36-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA. Translation: CAB92285.1.
AK123039 mRNA. Translation: BAC85521.1.
AC079296 Genomic DNA. No translation available.
BC111690 mRNA. Translation: AAI11691.1.
CCDSiCCDS53599.1. [Q9NQ36-3]
CCDS7797.2. [Q9NQ36-2]
RefSeqiNP_001164161.1. NM_001170690.1.
NP_066025.2. NM_020974.2.
XP_005253090.2. XM_005253033.3.
UniGeneiHs.523468.

3D structure databases

ProteinModelPortaliQ9NQ36.
SMRiQ9NQ36. Positions 45-213, 228-441, 809-918.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ9NQ36.
PhosphoSiteiQ9NQ36.

Polymorphism and mutation databases

BioMutaiSCUBE2.
DMDMi311033510.

Proteomic databases

PRIDEiQ9NQ36.

Protocols and materials databases

DNASUi57758.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309263; ENSP00000310658; ENSG00000175356.
ENST00000450649; ENSP00000415187; ENSG00000175356.
GeneIDi57758.
KEGGihsa:57758.
UCSCiuc001mhj.3. human. [Q9NQ36-1]

Organism-specific databases

CTDi57758.
GeneCardsiSCUBE2.
HGNCiHGNC:30425. SCUBE2.
HPAiHPA006353.
HPA029871.
MIMi611747. gene.
neXtProtiNX_Q9NQ36.
PharmGKBiPA134908812.
GenAtlasiSearch...

Phylogenomic databases

HOGENOMiHOG000230943.
HOVERGENiHBG054902.
InParanoidiQ9NQ36.
OrthoDBiEOG7P8P71.
PhylomeDBiQ9NQ36.
TreeFamiTF351672.

Enzyme and pathway databases

ReactomeiR-HSA-5362798. Release of Hh-Np from the secreting cell.

Miscellaneous databases

ChiTaRSiSCUBE2. human.
GenomeRNAii57758.
PROiQ9NQ36.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NQ36.
CleanExiHS_SCUBE2.
ExpressionAtlasiQ9NQ36. baseline and differential.
GenevisibleiQ9NQ36. HS.

Family and domain databases

Gene3Di2.60.120.290. 1 hit.
InterProiIPR026823. cEGF.
IPR000859. CUB_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom.
IPR009030. Growth_fac_rcpt_.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
[Graphical view]
PfamiPF12662. cEGF. 1 hit.
PF00431. CUB. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07699. Ephrin_rec_like. 3 hits.
[Graphical view]
SMARTiSM00042. CUB. 1 hit.
SM00181. EGF. 10 hits.
SM00179. EGF_CA. 8 hits.
SM01411. Ephrin_rec_like. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 1 hit.
SSF57184. SSF57184. 4 hits.
PROSITEiPS00010. ASX_HYDROXYL. 6 hits.
PS01180. CUB. 1 hit.
PS01186. EGF_2. 8 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 6 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7."
    Amid C., Bahr A., Mujica A., Sampson N., Bikar S.E., Winterpacht A., Zabel B., Hankeln T., Schmidt E.R.
    Cytogenet. Cell Genet. 93:284-290(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLN-712.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS MET-591 AND GLN-712.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT GLN-712.
  5. "Identification of a novel family of cell-surface proteins expressed in human vascular endothelium."
    Yang R.-B., Ng C.K.D., Wasserman S.M., Colman S.D., Shenoy S., Mehraban F., Koemueves L.G., Tomlinson J.E., Topper J.N.
    J. Biol. Chem. 277:46364-46373(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiSCUB2_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ36
Secondary accession number(s): Q2NKQ8, Q6ZWI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: November 2, 2010
Last modified: June 8, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.