Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C11orf16

Gene

C11orf16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C11orf16
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1169. C11orf16.

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiC11orf16.
DMDMi308153616.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 467467Uncharacterized protein C11orf16PRO_0000089832Add
BLAST

Proteomic databases

PaxDbiQ9NQ32.
PRIDEiQ9NQ32.

PTM databases

PhosphoSiteiQ9NQ32.

Expressioni

Gene expression databases

BgeeiENSG00000176029.
CleanExiHS_C11orf16.
ExpressionAtlasiQ9NQ32. baseline and differential.
GenevisibleiQ9NQ32. HS.

Interactioni

Protein-protein interaction databases

BioGridi121181. 2 interactions.
IntActiQ9NQ32. 2 interactions.
MINTiMINT-1469312.
STRINGi9606.ENSP00000318999.

Structurei

3D structure databases

ProteinModelPortaliQ9NQ32.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IKHI. Eukaryota.
ENOG410YKXR. LUCA.
GeneTreeiENSGT00390000012348.
HOGENOMiHOG000111719.
HOVERGENiHBG050973.
InParanoidiQ9NQ32.
OMAiWAPCCSL.
OrthoDBiEOG091G0A18.
PhylomeDBiQ9NQ32.
TreeFamiTF336135.

Family and domain databases

InterProiIPR032770. DUF4537.
[Graphical view]
PfamiPF15057. DUF4537. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NQ32-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESSTGPRMP LLKYCSVATS LKAPGWDGAA PPWDLSFTYP FALQAPWLTG
60 70 80 90 100
HKPLARHASS CPCLHVADPA WQGPGWLGRA GDAANTWVLA RREADGFYYR
110 120 130 140 150
AQIKATPELE RQGVLLVEFE APLVAGPKLP AQQQRVVLEE DVIPLSPSVG
160 170 180 190 200
YSLRPGDKVL ALWEPGQQQY GPGTVLLGLE MRDPQRASKE KEITVHFWNG
210 220 230 240 250
KAAKVPLGGV QSVSLTIWKK AVERLHKSFT REHPRPLHWA PCCSLLGPIT
260 270 280 290 300
GRITNELPPD APFLCPLCHH HACCQLLCQG CLCGCPPCGT TWWPLTRTSE
310 320 330 340 350
VMARELPELE PTAQLLPLEG PKEEKVAMHA PLAVSSSSSS SCEQDGVEND
360 370 380 390 400
LEMGPPQRLM VNSAVNTDPI FLEMPLRQSG LCQPEWRYWK RNGPEPCLGK
410 420 430 440 450
PGTRYSNICK EEKDHKQQRA QTAVVGTTKE LVSKATHMKP PRTPPGEAEH
460
RKRSQSLAIC QWNKNSR
Length:467
Mass (Da):51,609
Last modified:October 5, 2010 - v3
Checksum:i10FB8E35E60D2298
GO
Isoform 2 (identifier: Q9NQ32-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     403-467: TRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTPPGEAEHRKRSQSLAICQWNKNSR → KE

Show »
Length:404
Mass (Da):44,412
Checksum:iB7AA221DC6D6CEFF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti169 – 1691Q → R in BAD97097 (Ref. 2) Curated
Sequence conflicti311 – 3111P → A in BAD97097 (Ref. 2) Curated
Sequence conflicti311 – 3111P → A in AAH27865 (PubMed:15489334).Curated
Sequence conflicti398 – 3981L → P in CAB92289 (PubMed:11528127).Curated
Sequence conflicti398 – 3981L → P in BAD97097 (Ref. 2) Curated
Sequence conflicti398 – 3981L → P in AAH27865 (PubMed:15489334).Curated
Sequence conflicti423 – 4231A → V in CAB92289 (PubMed:11528127).Curated
Sequence conflicti423 – 4231A → V in BAD97097 (Ref. 2) Curated
Sequence conflicti442 – 4421R → Q in CAB92289 (PubMed:11528127).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti144 – 1441P → L.
Corresponds to variant rs2568076 [ dbSNP | Ensembl ].
VAR_056827
Natural varianti210 – 2101V → L.1 Publication
Corresponds to variant rs11042127 [ dbSNP | Ensembl ].
VAR_056828

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei403 – 46765TRYSN…NKNSR → KE in isoform 2. 1 PublicationVSP_039850Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA. Translation: CAB92289.1.
AK223377 mRNA. Translation: BAD97097.1.
AC026894 Genomic DNA. No translation available.
BC027865 mRNA. Translation: AAH27865.1.
CCDSiCCDS7794.1. [Q9NQ32-1]
RefSeqiNP_065694.2. NM_020643.2. [Q9NQ32-1]
UniGeneiHs.277349.

Genome annotation databases

EnsembliENST00000326053; ENSP00000318999; ENSG00000176029. [Q9NQ32-1]
ENST00000525780; ENSP00000436818; ENSG00000176029. [Q9NQ32-2]
GeneIDi56673.
KEGGihsa:56673.
UCSCiuc001mhb.5. human. [Q9NQ32-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA. Translation: CAB92289.1.
AK223377 mRNA. Translation: BAD97097.1.
AC026894 Genomic DNA. No translation available.
BC027865 mRNA. Translation: AAH27865.1.
CCDSiCCDS7794.1. [Q9NQ32-1]
RefSeqiNP_065694.2. NM_020643.2. [Q9NQ32-1]
UniGeneiHs.277349.

3D structure databases

ProteinModelPortaliQ9NQ32.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121181. 2 interactions.
IntActiQ9NQ32. 2 interactions.
MINTiMINT-1469312.
STRINGi9606.ENSP00000318999.

PTM databases

PhosphoSiteiQ9NQ32.

Polymorphism and mutation databases

BioMutaiC11orf16.
DMDMi308153616.

Proteomic databases

PaxDbiQ9NQ32.
PRIDEiQ9NQ32.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326053; ENSP00000318999; ENSG00000176029. [Q9NQ32-1]
ENST00000525780; ENSP00000436818; ENSG00000176029. [Q9NQ32-2]
GeneIDi56673.
KEGGihsa:56673.
UCSCiuc001mhb.5. human. [Q9NQ32-1]

Organism-specific databases

CTDi56673.
GeneCardsiC11orf16.
H-InvDBHIX0201631.
HGNCiHGNC:1169. C11orf16.
neXtProtiNX_Q9NQ32.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKHI. Eukaryota.
ENOG410YKXR. LUCA.
GeneTreeiENSGT00390000012348.
HOGENOMiHOG000111719.
HOVERGENiHBG050973.
InParanoidiQ9NQ32.
OMAiWAPCCSL.
OrthoDBiEOG091G0A18.
PhylomeDBiQ9NQ32.
TreeFamiTF336135.

Miscellaneous databases

GeneWikiiC11orf16.
GenomeRNAii56673.
PROiQ9NQ32.

Gene expression databases

BgeeiENSG00000176029.
CleanExiHS_C11orf16.
ExpressionAtlasiQ9NQ32. baseline and differential.
GenevisibleiQ9NQ32. HS.

Family and domain databases

InterProiIPR032770. DUF4537.
[Graphical view]
PfamiPF15057. DUF4537. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCK016_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ32
Secondary accession number(s): Q53FB2, Q8N6Y9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: October 5, 2010
Last modified: September 7, 2016
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.