Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NTF2-related export protein 2

Gene

NXT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
NTF2-related export protein 2
Alternative name(s):
Protein p15-2
Gene namesi
Name:NXT2
ORF Names:BM-025, DC9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:18151. NXT2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134928861.

Polymorphism and mutation databases

BioMutaiNXT2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 142142NTF2-related export protein 2PRO_0000194795Add
BLAST

Proteomic databases

EPDiQ9NPJ8.
MaxQBiQ9NPJ8.
PaxDbiQ9NPJ8.
PRIDEiQ9NPJ8.

PTM databases

iPTMnetiQ9NPJ8.

Expressioni

Gene expression databases

BgeeiQ9NPJ8.
CleanExiHS_NXT2.
GenevisibleiQ9NPJ8. HS.

Organism-specific databases

HPAiHPA024199.

Interactioni

Subunit structurei

Associates with NXF1, NXF2, NXF3 and NXF5.

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC102BA1A4H13EBI-752122,EBI-10171570
CEP63Q96MT83EBI-752122,EBI-741977
GOLGA2Q083793EBI-752122,EBI-618309
HEL-S-30V9HWB83EBI-752122,EBI-10215395
LNX1Q8TBB13EBI-752122,EBI-739832
NXF3Q9H4D57EBI-752122,EBI-750038
PTPN3P260453EBI-752122,EBI-1047946
RELQ048643EBI-752122,EBI-307352
SSBP3Q9BWW43EBI-752122,EBI-2902395
TRIM23P364063EBI-752122,EBI-740098
USP54Q70EL13EBI-752122,EBI-946185

Protein-protein interaction databases

BioGridi120999. 24 interactions.
IntActiQ9NPJ8. 15 interactions.
MINTiMINT-1435138.
STRINGi9606.ENSP00000218004.

Structurei

3D structure databases

ProteinModelPortaliQ9NPJ8.
SMRiQ9NPJ8. Positions 4-141.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini17 – 136120NTF2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 NTF2 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4353. Eukaryota.
ENOG4111TWR. LUCA.
GeneTreeiENSGT00510000046494.
HOVERGENiHBG018207.
InParanoidiQ9NPJ8.
KOiK14285.
OMAiDKWKIVS.
OrthoDBiEOG7966J7.
PhylomeDBiQ9NPJ8.
TreeFamiTF318944.

Family and domain databases

Gene3Di3.10.450.50. 1 hit.
InterProiIPR002075. NTF2.
IPR032710. NTF2-like_dom.
IPR018222. Nuclear_transport_factor_2_euk.
[Graphical view]
PfamiPF02136. NTF2. 1 hit.
[Graphical view]
SUPFAMiSSF54427. SSF54427. 1 hit.
PROSITEiPS50177. NTF2_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NPJ8-1) [UniParc]FASTAAdd to basket

Also known as: A, p15-2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATSLDFKTY VDQACRAAEE FVNIYYETMD KRRRALTRLY LDKATLIWNG
60 70 80 90 100
NAVSGLDALN NFFDTLPSSE FQVNMLDCQP VHEQATQSQT TVLVVTSGTV
110 120 130 140
KFDGNKQHFF NQNFLLTAQS TPNNTVWKIA SDCFRFQDWS SS
Length:142
Mass (Da):16,228
Last modified:October 1, 2000 - v1
Checksum:i009B4E8929A6BA6C
GO
Isoform 2 (identifier: Q9NPJ8-2) [UniParc]FASTAAdd to basket

Also known as: B, p15-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MATSL → VTNHVPALCTAGRGPRFAARPAGPTPSLVSSRFLIPERTLSWEIARGGDVG

Note: Incomplete sequence.
Show »
Length:188
Mass (Da):21,050
Checksum:i571C1FF74EE21CB1
GO
Isoform 3 (identifier: Q9NPJ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQM

Show »
Length:197
Mass (Da):22,728
Checksum:i47BD5E5D4A8C18F9
GO
Isoform 4 (identifier: Q9NPJ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.

Show »
Length:114
Mass (Da):12,967
Checksum:i4794D8D4893867F4
GO

Sequence cautioni

The sequence BAB14511.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2828Missing in isoform 4. 1 PublicationVSP_037539Add
BLAST
Alternative sequencei1 – 55MATSL → VTNHVPALCTAGRGPRFAAR PAGPTPSLVSSRFLIPERTL SWEIARGGDVG in isoform 2. 1 PublicationVSP_003604
Alternative sequencei1 – 11M → MRKYRSHWSQGDREGYQRRS NYYEGPHTSHSSPADRTREE VVTPTLPEHTATRSQM in isoform 3. 1 PublicationVSP_037540

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277591 mRNA. Translation: CAB96371.1.
AJ278323 mRNA. Translation: CAC01129.1.
AF246127 mRNA. Translation: AAF78034.1.
AF201942 mRNA. Translation: AAF86878.1.
AF212223 mRNA. Translation: AAF87325.1.
AK023289 mRNA. Translation: BAB14511.1. Different initiation.
AL031387 Genomic DNA. Translation: CAI42967.1.
AL031387 Genomic DNA. Translation: CAI42968.1.
AL031387 Genomic DNA. Translation: CAI42969.1.
CH471120 Genomic DNA. Translation: EAX02677.1.
CH471120 Genomic DNA. Translation: EAX02678.1.
BC014888 mRNA. No translation available.
CH471120 Genomic DNA. Translation: EAX02680.1.
BC120984 mRNA. Translation: AAI20985.1.
BC120985 mRNA. Translation: AAI20986.1.
CCDSiCCDS14546.1. [Q9NPJ8-3]
CCDS56605.1. [Q9NPJ8-1]
CCDS56606.1. [Q9NPJ8-4]
RefSeqiNP_001229546.1. NM_001242617.1. [Q9NPJ8-1]
NP_001229547.1. NM_001242618.1. [Q9NPJ8-4]
NP_061168.2. NM_018698.4. [Q9NPJ8-3]
UniGeneiHs.25010.

Genome annotation databases

EnsembliENST00000218004; ENSP00000218004; ENSG00000101888. [Q9NPJ8-3]
ENST00000372103; ENSP00000361175; ENSG00000101888. [Q9NPJ8-4]
ENST00000372106; ENSP00000361178; ENSG00000101888. [Q9NPJ8-1]
ENST00000372107; ENSP00000361179; ENSG00000101888. [Q9NPJ8-4]
GeneIDi55916.
KEGGihsa:55916.
UCSCiuc004eoe.3. human. [Q9NPJ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277591 mRNA. Translation: CAB96371.1.
AJ278323 mRNA. Translation: CAC01129.1.
AF246127 mRNA. Translation: AAF78034.1.
AF201942 mRNA. Translation: AAF86878.1.
AF212223 mRNA. Translation: AAF87325.1.
AK023289 mRNA. Translation: BAB14511.1. Different initiation.
AL031387 Genomic DNA. Translation: CAI42967.1.
AL031387 Genomic DNA. Translation: CAI42968.1.
AL031387 Genomic DNA. Translation: CAI42969.1.
CH471120 Genomic DNA. Translation: EAX02677.1.
CH471120 Genomic DNA. Translation: EAX02678.1.
BC014888 mRNA. No translation available.
CH471120 Genomic DNA. Translation: EAX02680.1.
BC120984 mRNA. Translation: AAI20985.1.
BC120985 mRNA. Translation: AAI20986.1.
CCDSiCCDS14546.1. [Q9NPJ8-3]
CCDS56605.1. [Q9NPJ8-1]
CCDS56606.1. [Q9NPJ8-4]
RefSeqiNP_001229546.1. NM_001242617.1. [Q9NPJ8-1]
NP_001229547.1. NM_001242618.1. [Q9NPJ8-4]
NP_061168.2. NM_018698.4. [Q9NPJ8-3]
UniGeneiHs.25010.

3D structure databases

ProteinModelPortaliQ9NPJ8.
SMRiQ9NPJ8. Positions 4-141.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120999. 24 interactions.
IntActiQ9NPJ8. 15 interactions.
MINTiMINT-1435138.
STRINGi9606.ENSP00000218004.

PTM databases

iPTMnetiQ9NPJ8.

Polymorphism and mutation databases

BioMutaiNXT2.

Proteomic databases

EPDiQ9NPJ8.
MaxQBiQ9NPJ8.
PaxDbiQ9NPJ8.
PRIDEiQ9NPJ8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000218004; ENSP00000218004; ENSG00000101888. [Q9NPJ8-3]
ENST00000372103; ENSP00000361175; ENSG00000101888. [Q9NPJ8-4]
ENST00000372106; ENSP00000361178; ENSG00000101888. [Q9NPJ8-1]
ENST00000372107; ENSP00000361179; ENSG00000101888. [Q9NPJ8-4]
GeneIDi55916.
KEGGihsa:55916.
UCSCiuc004eoe.3. human. [Q9NPJ8-1]

Organism-specific databases

CTDi55916.
GeneCardsiNXT2.
HGNCiHGNC:18151. NXT2.
HPAiHPA024199.
MIMi300320. gene.
neXtProtiNX_Q9NPJ8.
PharmGKBiPA134928861.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4353. Eukaryota.
ENOG4111TWR. LUCA.
GeneTreeiENSGT00510000046494.
HOVERGENiHBG018207.
InParanoidiQ9NPJ8.
KOiK14285.
OMAiDKWKIVS.
OrthoDBiEOG7966J7.
PhylomeDBiQ9NPJ8.
TreeFamiTF318944.

Miscellaneous databases

GenomeRNAii55916.
PROiQ9NPJ8.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NPJ8.
CleanExiHS_NXT2.
GenevisibleiQ9NPJ8. HS.

Family and domain databases

Gene3Di3.10.450.50. 1 hit.
InterProiIPR002075. NTF2.
IPR032710. NTF2-like_dom.
IPR018222. Nuclear_transport_factor_2_euk.
[Graphical view]
PfamiPF02136. NTF2. 1 hit.
[Graphical view]
SUPFAMiSSF54427. SSF54427. 1 hit.
PROSITEiPS50177. NTF2_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture."
    Herold A., Suyama M., Rodrigues J.P., Braun I.C., Kutay U., Carmo-Fonseca M., Bork P., Izaurralde E.
    Mol. Cell. Biol. 20:8996-9008(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  2. "p15-2, a homologous protein of p15, interacts with Tap."
    Kang Y., Cullen B.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Novel genes expressed in human dendritic cell."
    Li Y., Peng Y., Li N., Gu W., Han Z., Fu G., Chen Z.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Dendritic cell.
  4. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Bone marrow.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Ovarian carcinoma.
  6. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Uterus.

Entry informationi

Entry nameiNXT2_HUMAN
AccessioniPrimary (citable) accession number: Q9NPJ8
Secondary accession number(s): D3DUY1
, Q0VAN8, Q5JYV5, Q5JYV6, Q5JYV7, Q9H8U0, Q9NQ64, Q9NRL7, Q9Y3M4, Q9Y3M5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2001
Last sequence update: October 1, 2000
Last modified: June 8, 2016
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.