Q9NPJ4 (PNRC2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proline-rich nuclear receptor coactivator 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 139 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for UPF1/RENT1 localization to the P-body. Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure. Ref.1 Ref.7 |
| Subunit structure | Interacts with UPF1/RENT1; preferentially interacts with hyperphosphorylated form. Interacts with DCP1A. Interacts with many nuclear receptors including ESR1, ESRRA, ESRRG, NR3C1/GR, NR5A1, PGR, TR, RAR and RXR. Ref.1 Ref.6 Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed in heart, lung, muscle and brain. Ref.1 |
| Domain | The interaction between PNRC2 and nuclear receptors is dependent on the SH3 binding motif. Ref.1 |
| Sequence similarities | Belongs to the PNRC family. PNRC2 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Nonsense-mediated mRNA decay Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Activator |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | deadenylation-independent decapping of nuclear-transcribed mRNA Traceable author statement Ref.7. Source: UniProtKB nuclear-transcribed mRNA catabolic process, nonsense-mediated decayInferred from direct assay Ref.7. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasmic mRNA processing body Inferred from direct assay Ref.7. Source: UniProtKB nucleusInferred from direct assay Ref.7. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| UPF1 | Q92900 | 9 | EBI-726549,EBI-373471 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NPJ4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NPJ4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MGGGERYNIP...RGHGYNSSAA → MLASAPRLNSADRPMKTSVLRQRKGSVRKQHLLSW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 139 | 139 | Proline-rich nuclear receptor coactivator 2 | PRO_0000058485 | |||||
Regions | |||||||||
| Motif | 99 – 105 | 7 | SH3-binding | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 54 | 54 | MGGGE…NSSAA → MLASAPRLNSADRPMKTSVL RQRKGSVRKQHLLSW in isoform 2. | VSP_037463 | |||||
Experimental info | |||||||||
| Mutagenesis | 101 | 1 | P → A: Abolishes the interaction with the nuclear receptors; when associated with A-104. Ref.1 | ||||||
| Mutagenesis | 104 | 1 | P → A: Abolishes the interaction with the nuclear receptors; when associated with A-101. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PNRC2 is a 16 kDa coactivator that interacts with nuclear receptors through an SH3-binding motif." Zhou D., Chen S. Nucleic Acids Res. 29:3939-3948(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DOMAIN, MUTAGENESIS OF PRO-101 AND PRO-104, INTERACTION WITH ESR1; ESRRA; NR3C1; NR5A1; PGR; TR; RAR AND RXR. |
| [2] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Umbilical cord blood. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Prostate. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung, Ovary and Uterus. |
| [6] | "Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma." Hentschke M., Borgmeyer U. Biochem. Biophys. Res. Commun. 312:975-982(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ESRRG. |
| [7] | "Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex." Cho H., Kim K.M., Kim Y.K. Mol. Cell 33:75-86(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH UPF1 AND DCP1A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF374386 mRNA. Translation: AAK54613.1. AF151042 mRNA. Translation: AAF36128.1. AK000319 mRNA. Translation: BAA91082.1. AK300522 mRNA. Translation: BAG62234.1. AL590609 Genomic DNA. Translation: CAI14802.1. BC001959 mRNA. Translation: AAH01959.1. BC078177 mRNA. Translation: AAH78177.1. BC085018 mRNA. Translation: AAH85018.1. | ||||||||||||
| IPI | IPI00015681. IPI00910406. | ||||||||||||
| RefSeq | NP_060231.1. NM_017761.3. XP_003846464.1. XM_003846416.1. XP_003846465.1. XM_003846417.1. XP_003846466.1. XM_003846418.1. XP_003846467.1. XM_003846419.1. XP_003846468.1. XM_003846420.1. XP_003846469.1. XM_003846421.1. XP_003846470.1. XM_003846422.2. XP_003846471.1. XM_003846423.1. | ||||||||||||
| UniGene | Hs.512636. Hs.644217. Hs.716935. Hs.7862. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NPJ4. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9NPJ4. 4 interactions. | ||||||||||||
| MINT | MINT-215468. | ||||||||||||
| STRING | 9606.ENSP00000334840. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NPJ4. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9NPJ4. | ||||||||||||
| PRIDE | Q9NPJ4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000334351; ENSP00000334840; ENSG00000189266. ENST00000374468; ENSP00000363592; ENSG00000189266. | ||||||||||||
| GeneID | 100996626. 55629. | ||||||||||||
| KEGG | hsa:100996626. hsa:55629. | ||||||||||||
| UCSC | uc001big.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55629. | ||||||||||||
| GeneCards | GC01P024285. | ||||||||||||
| H-InvDB | HIX0028821. | ||||||||||||
| HGNC | HGNC:23158. PNRC2. | ||||||||||||
| HPA | HPA027820. | ||||||||||||
| MIM | 611882. gene. | ||||||||||||
| neXtProt | NX_Q9NPJ4. | ||||||||||||
| PharmGKB | PA134931421. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG45103. | ||||||||||||
| HOGENOM | HOG000115593. | ||||||||||||
| HOVERGEN | HBG053627. | ||||||||||||
| InParanoid | Q9NPJ4. | ||||||||||||
| OMA | ERGHTYN. | ||||||||||||
| OrthoDB | EOG4T4CWV. | ||||||||||||
| PhylomeDB | Q9NPJ4. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q9NPJ4. | ||||||||||||
| CleanEx | HS_PNRC2. | ||||||||||||
| Genevestigator | Q9NPJ4. | ||||||||||||
| GermOnline | ENSG00000189266. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR026781. PNRC2. [Graphical view] | ||||||||||||
| PANTHER | PTHR32216. PTHR32216. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 60261. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PNRC2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NPJ4 Secondary accession number(s): B4DU72 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
