Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-18

Gene

RAB18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi15 – 239GTP
Nucleotide bindingi63 – 675GTP
Nucleotide bindingi122 – 1254GTP
Nucleotide bindingi151 – 1533GTP

GO - Molecular functioni

  1. GDP binding Source: UniProtKB
  2. GTPase activity Source: UniProtKB
  3. GTP binding Source: GO_Central

GO - Biological processi

  1. brain development Source: UniProtKB
  2. endoplasmic reticulum tubular network organization Source: UniProtKB
  3. eye development Source: UniProtKB
  4. intracellular protein transport Source: GO_Central
  5. lipid particle organization Source: MGI
  6. metabolic process Source: GOC
  7. Rab protein signal transduction Source: GO_Central
  8. small GTPase mediated signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-18
Gene namesi
Name:RAB18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:14244. RAB18.

Subcellular locationi

Cell membrane Curated; Lipid-anchor Curated; Cytoplasmic side Curated

GO - Cellular componenti

  1. endoplasmic reticulum tubular network Source: UniProtKB
  2. extracellular vesicular exosome Source: UniProtKB
  3. Golgi apparatus Source: GO_Central
  4. intracellular Source: LIFEdb
  5. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Warburg micro syndrome 3 (WARBM3)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism.

See also OMIM:614222
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → Q in WARBM3. 1 Publication
VAR_066495
Natural varianti93 – 931Missing in WARBM3. 1 Publication
VAR_066496

Organism-specific databases

MIMi614222. phenotype.
Orphaneti2510. Micro syndrome.
PharmGKBiPA34106.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 203203Ras-related protein Rab-18PRO_0000121193Add
BLAST
Propeptidei204 – 2063Removed in mature formSequence AnalysisPRO_0000370761

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications
Lipidationi199 – 1991S-palmitoyl cysteineSequence Analysis
Modified residuei203 – 2031Cysteine methyl esterSequence Analysis
Lipidationi203 – 2031S-geranylgeranyl cysteineBy similarity

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Prenylation

Proteomic databases

MaxQBiQ9NP72.
PaxDbiQ9NP72.
PRIDEiQ9NP72.

PTM databases

PhosphoSiteiQ9NP72.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiQ9NP72.
CleanExiHS_RAB18.
ExpressionAtlasiQ9NP72. baseline and differential.
GenevestigatoriQ9NP72.

Organism-specific databases

HPAiHPA025928.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q99IB85EBI-722247,EBI-6927873From a different organism.

Protein-protein interaction databases

BioGridi116591. 17 interactions.
DIPiDIP-60514N.
IntActiQ9NP72. 7 interactions.
MINTiMINT-5003598.
STRINGi9606.ENSP00000349415.

Structurei

Secondary structure

1
206
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi5 – 1410Combined sources
Helixi21 – 3010Combined sources
Beta strandi42 – 5211Combined sources
Beta strandi55 – 6410Combined sources
Helixi68 – 703Combined sources
Helixi74 – 785Combined sources
Beta strandi83 – 897Combined sources
Helixi93 – 975Combined sources
Helixi99 – 1068Combined sources
Beta strandi116 – 1227Combined sources
Beta strandi126 – 1283Combined sources
Helixi133 – 14210Combined sources
Beta strandi146 – 1494Combined sources
Turni152 – 1543Combined sources
Helixi158 – 17013Combined sources
Helixi173 – 1753Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X3SX-ray1.32A1-182[»]
ProteinModelPortaliQ9NP72.
SMRiQ9NP72. Positions 2-178.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NP72.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi37 – 459Effector regionBy similarity

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00740000115017.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ9NP72.
KOiK07910.
OMAiVICVYDV.
OrthoDBiEOG7CVQ04.
PhylomeDBiQ9NP72.
TreeFamiTF313448.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR025662. Sigma_54_int_dom_ATP-bd_1.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NP72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEDVLTTLK ILIIGESGVG KSSLLLRFTD DTFDPELAAT IGVDFKVKTI
60 70 80 90 100
SVDGNKAKLA IWDTAGQERF RTLTPSYYRG AQGVILVYDV TRRDTFVKLD
110 120 130 140 150
NWLNELETYC TRNDIVNMLV GNKIDKENRE VDRNEGLKFA RKHSMLFIEA
160 170 180 190 200
SAKTCDGVQC AFEELVEKII QTPGLWESEN QNKGVKLSHR EEGQGGGACG

GYCSVL
Length:206
Mass (Da):22,977
Last modified:September 30, 2000 - v1
Checksum:iD1B0F4866547DF77
GO
Isoform 2 (identifier: Q9NP72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: W → WVTLHQQTANFFLKSQIGNSPILKWAMWQY

Note: Highly expressed in testis.

Show »
Length:235
Mass (Da):26,410
Checksum:i3E11FA232CFEDCFF
GO
Isoform 3 (identifier: Q9NP72-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-126: Missing.

Note: No experimental confirmation available.

Show »
Length:142
Mass (Da):15,508
Checksum:i9B8066F80314F7A0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611I → L in BAD96873 (Ref. 11) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → Q in WARBM3. 1 Publication
VAR_066495
Natural varianti93 – 931Missing in WARBM3. 1 Publication
VAR_066496
Natural varianti113 – 1131N → S.
Corresponds to variant rs12268932 [ dbSNP | Ensembl ].
VAR_051713
Natural varianti198 – 1981A → T.
Corresponds to variant rs11015859 [ dbSNP | Ensembl ].
VAR_034432

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei62 – 621W → WVTLHQQTANFFLKSQIGNS PILKWAMWQY in isoform 2. 1 PublicationVSP_043912
Alternative sequencei63 – 12664Missing in isoform 3. 1 PublicationVSP_044883Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277145
, AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA. Translation: CAB86486.1.
AF137372 mRNA. Translation: AAF61433.1.
AY574034 mRNA. Translation: AAU08232.1.
AF087860 mRNA. Translation: AAP97170.1.
AF498950 mRNA. Translation: AAM21098.1.
AF136974 mRNA. Translation: AAG49435.1.
AL136734 mRNA. Translation: CAB66668.1.
BT009840 mRNA. Translation: AAP88842.1.
CR533455 mRNA. Translation: CAG38486.1.
AK001555 mRNA. Translation: BAG50939.1.
AK295443 mRNA. Translation: BAH12069.1.
AK223153 mRNA. Translation: BAD96873.1.
AL138920 Genomic DNA. Translation: CAH70590.1.
CH471072 Genomic DNA. Translation: EAW86054.1.
CH471072 Genomic DNA. Translation: EAW86055.1.
BC015014 mRNA. Translation: AAH15014.1.
BC029350 mRNA. Translation: AAH29350.1.
CCDSiCCDS58073.1. [Q9NP72-3]
CCDS7155.1. [Q9NP72-1]
CCDS73081.1. [Q9NP72-2]
RefSeqiNP_001243339.1. NM_001256410.1. [Q9NP72-2]
NP_001243340.1. NM_001256411.1.
NP_001243341.1. NM_001256412.1. [Q9NP72-3]
NP_001243344.1. NM_001256415.1.
NP_067075.1. NM_021252.4. [Q9NP72-1]
UniGeneiHs.406799.

Genome annotation databases

EnsembliENST00000356940; ENSP00000349415; ENSG00000099246. [Q9NP72-1]
ENST00000535776; ENSP00000439321; ENSG00000099246. [Q9NP72-3]
ENST00000621805; ENSP00000478479; ENSG00000099246. [Q9NP72-2]
GeneIDi22931.
KEGGihsa:22931.
UCSCiuc001itv.4. human. [Q9NP72-1]
uc001itw.4. human. [Q9NP72-2]
uc010qdr.3. human.

Polymorphism databases

DMDMi12230528.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277145
, AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA. Translation: CAB86486.1.
AF137372 mRNA. Translation: AAF61433.1.
AY574034 mRNA. Translation: AAU08232.1.
AF087860 mRNA. Translation: AAP97170.1.
AF498950 mRNA. Translation: AAM21098.1.
AF136974 mRNA. Translation: AAG49435.1.
AL136734 mRNA. Translation: CAB66668.1.
BT009840 mRNA. Translation: AAP88842.1.
CR533455 mRNA. Translation: CAG38486.1.
AK001555 mRNA. Translation: BAG50939.1.
AK295443 mRNA. Translation: BAH12069.1.
AK223153 mRNA. Translation: BAD96873.1.
AL138920 Genomic DNA. Translation: CAH70590.1.
CH471072 Genomic DNA. Translation: EAW86054.1.
CH471072 Genomic DNA. Translation: EAW86055.1.
BC015014 mRNA. Translation: AAH15014.1.
BC029350 mRNA. Translation: AAH29350.1.
CCDSiCCDS58073.1. [Q9NP72-3]
CCDS7155.1. [Q9NP72-1]
CCDS73081.1. [Q9NP72-2]
RefSeqiNP_001243339.1. NM_001256410.1. [Q9NP72-2]
NP_001243340.1. NM_001256411.1.
NP_001243341.1. NM_001256412.1. [Q9NP72-3]
NP_001243344.1. NM_001256415.1.
NP_067075.1. NM_021252.4. [Q9NP72-1]
UniGeneiHs.406799.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X3SX-ray1.32A1-182[»]
ProteinModelPortaliQ9NP72.
SMRiQ9NP72. Positions 2-178.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116591. 17 interactions.
DIPiDIP-60514N.
IntActiQ9NP72. 7 interactions.
MINTiMINT-5003598.
STRINGi9606.ENSP00000349415.

PTM databases

PhosphoSiteiQ9NP72.

Polymorphism databases

DMDMi12230528.

Proteomic databases

MaxQBiQ9NP72.
PaxDbiQ9NP72.
PRIDEiQ9NP72.

Protocols and materials databases

DNASUi22931.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356940; ENSP00000349415; ENSG00000099246. [Q9NP72-1]
ENST00000535776; ENSP00000439321; ENSG00000099246. [Q9NP72-3]
ENST00000621805; ENSP00000478479; ENSG00000099246. [Q9NP72-2]
GeneIDi22931.
KEGGihsa:22931.
UCSCiuc001itv.4. human. [Q9NP72-1]
uc001itw.4. human. [Q9NP72-2]
uc010qdr.3. human.

Organism-specific databases

CTDi22931.
GeneCardsiGC10P027793.
HGNCiHGNC:14244. RAB18.
HPAiHPA025928.
MIMi602207. gene.
614222. phenotype.
neXtProtiNX_Q9NP72.
Orphaneti2510. Micro syndrome.
PharmGKBiPA34106.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00740000115017.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
InParanoidiQ9NP72.
KOiK07910.
OMAiVICVYDV.
OrthoDBiEOG7CVQ04.
PhylomeDBiQ9NP72.
TreeFamiTF313448.

Miscellaneous databases

ChiTaRSiRAB18. human.
EvolutionaryTraceiQ9NP72.
GeneWikiiRAB18.
GenomeRNAii22931.
NextBioi43659.
PROiQ9NP72.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NP72.
CleanExiHS_RAB18.
ExpressionAtlasiQ9NP72. baseline and differential.
GenevestigatoriQ9NP72.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR025662. Sigma_54_int_dom_ATP-bd_1.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "In silico cloning of the human Rab18 gene."
    Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. "Isolation and characterisation of the human rab18 gene after stimulation of endothelial cells with histamine."
    Schaefer U., Seibold S., Schneider A., Neugebauer E.
    FEBS Lett. 466:148-154(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning and characterization of a novel splice variant of human Rab18 gene (RAB18)."
    Dou T., Ji C., Gu S., Chen F., Xu J., Ye X., Ying K., Xie Y., Mao Y.
    DNA Seq. 16:230-234(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  4. "Cloning and expression of a novel human cDNA homologous to murine ras-related protein (rab18) mRNA."
    Cui W.C., Yu L., Liu Q., Lin W., Han X.F., Zhao S.Y.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Puhl H.L. III, Ikeda S.R., Aronstam R.S.
    Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adrenal gland.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  8. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Corpus callosum.
  11. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  12. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus and Skin.
  15. Bienvenut W.V., Waridel P., Quadroni M.
    Submitted (FEB-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1-21; 59-69 AND 99-123, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryonic kidney.
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "Crystal structure of human RAB18 in complex with GPPNHP."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JAN-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.32 ANGSTROMS) OF 1-184 IN COMPLEX WITH GTP ANALOG.
  19. Cited for: VARIANTS WARBM3 GLN-24 AND ARG-93 DEL, FUNCTION.

Entry informationi

Entry nameiRAB18_HUMAN
AccessioniPrimary (citable) accession number: Q9NP72
Secondary accession number(s): B3KMC7
, B7Z333, D3DRW1, Q53FX8, Q56UN9, Q6FIH1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2001
Last sequence update: September 30, 2000
Last modified: March 31, 2015
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.