Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NP72

- RAB18_HUMAN

UniProt

Q9NP72 - RAB18_HUMAN

Protein

Ras-related protein Rab-18

Gene

RAB18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 145 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi15 – 239GTP
    Nucleotide bindingi63 – 675GTP
    Nucleotide bindingi122 – 1254GTP
    Nucleotide bindingi151 – 1533GTP

    GO - Molecular functioni

    1. GDP binding Source: UniProtKB
    2. GTPase activity Source: UniProtKB
    3. GTP binding Source: UniProtKB-KW
    4. protein binding Source: IntAct

    GO - Biological processi

    1. brain development Source: UniProtKB
    2. eye development Source: UniProtKB
    3. GTP catabolic process Source: GOC
    4. lipid particle organization Source: MGI
    5. protein transport Source: UniProtKB-KW
    6. small GTPase mediated signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Protein transport, Transport

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras-related protein Rab-18
    Gene namesi
    Name:RAB18
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:14244. RAB18.

    Subcellular locationi

    Cell membrane Curated; Lipid-anchor Curated; Cytoplasmic side Curated

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. intracellular Source: LIFEdb
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Warburg micro syndrome 3 (WARBM3) [MIM:614222]: A rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti24 – 241L → Q in WARBM3. 1 Publication
    VAR_066495
    Natural varianti93 – 931Missing in WARBM3. 1 Publication
    VAR_066496

    Organism-specific databases

    MIMi614222. phenotype.
    Orphaneti2510. Micro syndrome.
    PharmGKBiPA34106.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 203203Ras-related protein Rab-18PRO_0000121193Add
    BLAST
    Propeptidei204 – 2063Removed in mature formSequence AnalysisPRO_0000370761

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine2 Publications
    Lipidationi199 – 1991S-palmitoyl cysteineSequence Analysis
    Modified residuei203 – 2031Cysteine methyl esterSequence Analysis
    Lipidationi203 – 2031S-geranylgeranyl cysteineBy similarity

    Keywords - PTMi

    Acetylation, Lipoprotein, Methylation, Palmitate, Prenylation

    Proteomic databases

    MaxQBiQ9NP72.
    PaxDbiQ9NP72.
    PRIDEiQ9NP72.

    PTM databases

    PhosphoSiteiQ9NP72.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiQ9NP72.
    BgeeiQ9NP72.
    CleanExiHS_RAB18.
    GenevestigatoriQ9NP72.

    Organism-specific databases

    HPAiHPA025928.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Q99IB85EBI-722247,EBI-6927873From a different organism.

    Protein-protein interaction databases

    BioGridi116591. 7 interactions.
    DIPiDIP-60514N.
    IntActiQ9NP72. 7 interactions.
    MINTiMINT-5003598.
    STRINGi9606.ENSP00000349415.

    Structurei

    Secondary structure

    1
    206
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi5 – 1410
    Helixi21 – 3010
    Beta strandi42 – 5211
    Beta strandi55 – 6410
    Helixi68 – 703
    Helixi74 – 785
    Beta strandi83 – 897
    Helixi93 – 975
    Helixi99 – 1068
    Beta strandi116 – 1227
    Beta strandi126 – 1283
    Helixi133 – 14210
    Beta strandi146 – 1494
    Turni152 – 1543
    Helixi158 – 17013
    Helixi173 – 1753

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1X3SX-ray1.32A1-182[»]
    ProteinModelPortaliQ9NP72.
    SMRiQ9NP72. Positions 2-178.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9NP72.

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi37 – 459Effector regionBy similarity

    Sequence similaritiesi

    Belongs to the small GTPase superfamily. Rab family.Curated

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000233968.
    HOVERGENiHBG009351.
    KOiK07910.
    OMAiTYTTRND.
    OrthoDBiEOG7CVQ04.
    PhylomeDBiQ9NP72.
    TreeFamiTF313448.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR027417. P-loop_NTPase.
    IPR025662. Sigma_54_int_dom_ATP-bd_1.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view]
    PfamiPF00071. Ras. 1 hit.
    [Graphical view]
    PRINTSiPR00449. RASTRNSFRMNG.
    SMARTiSM00175. RAB. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51419. RAB. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NP72-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDEDVLTTLK ILIIGESGVG KSSLLLRFTD DTFDPELAAT IGVDFKVKTI    50
    SVDGNKAKLA IWDTAGQERF RTLTPSYYRG AQGVILVYDV TRRDTFVKLD 100
    NWLNELETYC TRNDIVNMLV GNKIDKENRE VDRNEGLKFA RKHSMLFIEA 150
    SAKTCDGVQC AFEELVEKII QTPGLWESEN QNKGVKLSHR EEGQGGGACG 200
    GYCSVL 206
    Length:206
    Mass (Da):22,977
    Last modified:October 1, 2000 - v1
    Checksum:iD1B0F4866547DF77
    GO
    Isoform 2 (identifier: Q9NP72-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         62-62: W → WVTLHQQTANFFLKSQIGNSPILKWAMWQY

    Note: Highly expressed in testis.

    Show »
    Length:235
    Mass (Da):26,410
    Checksum:i3E11FA232CFEDCFF
    GO
    Isoform 3 (identifier: Q9NP72-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-126: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:142
    Mass (Da):15,508
    Checksum:i9B8066F80314F7A0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti61 – 611I → L in BAD96873. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti24 – 241L → Q in WARBM3. 1 Publication
    VAR_066495
    Natural varianti93 – 931Missing in WARBM3. 1 Publication
    VAR_066496
    Natural varianti113 – 1131N → S.
    Corresponds to variant rs12268932 [ dbSNP | Ensembl ].
    VAR_051713
    Natural varianti198 – 1981A → T.
    Corresponds to variant rs11015859 [ dbSNP | Ensembl ].
    VAR_034432

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei62 – 621W → WVTLHQQTANFFLKSQIGNS PILKWAMWQY in isoform 2. 1 PublicationVSP_043912
    Alternative sequencei63 – 12664Missing in isoform 3. 1 PublicationVSP_044883Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ277145
    , AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA. Translation: CAB86486.1.
    AF137372 mRNA. Translation: AAF61433.1.
    AY574034 mRNA. Translation: AAU08232.1.
    AF087860 mRNA. Translation: AAP97170.1.
    AF498950 mRNA. Translation: AAM21098.1.
    AF136974 mRNA. Translation: AAG49435.1.
    AL136734 mRNA. Translation: CAB66668.1.
    BT009840 mRNA. Translation: AAP88842.1.
    CR533455 mRNA. Translation: CAG38486.1.
    AK001555 mRNA. Translation: BAG50939.1.
    AK295443 mRNA. Translation: BAH12069.1.
    AK223153 mRNA. Translation: BAD96873.1.
    AL138920 Genomic DNA. Translation: CAH70590.1.
    CH471072 Genomic DNA. Translation: EAW86054.1.
    CH471072 Genomic DNA. Translation: EAW86055.1.
    BC015014 mRNA. Translation: AAH15014.1.
    BC029350 mRNA. Translation: AAH29350.1.
    CCDSiCCDS58073.1. [Q9NP72-3]
    CCDS7155.1. [Q9NP72-1]
    RefSeqiNP_001243339.1. NM_001256410.1. [Q9NP72-2]
    NP_001243340.1. NM_001256411.1.
    NP_001243341.1. NM_001256412.1. [Q9NP72-3]
    NP_001243344.1. NM_001256415.1.
    NP_067075.1. NM_021252.4. [Q9NP72-1]
    UniGeneiHs.406799.

    Genome annotation databases

    EnsembliENST00000356940; ENSP00000349415; ENSG00000099246. [Q9NP72-1]
    ENST00000535776; ENSP00000439321; ENSG00000099246. [Q9NP72-3]
    GeneIDi22931.
    KEGGihsa:22931.
    UCSCiuc001itv.4. human. [Q9NP72-1]
    uc001itw.4. human. [Q9NP72-2]
    uc010qdr.3. human.

    Polymorphism databases

    DMDMi12230528.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ277145
    , AJ277146 , AJ277147 , AJ277148 , AJ277149 Genomic DNA. Translation: CAB86486.1 .
    AF137372 mRNA. Translation: AAF61433.1 .
    AY574034 mRNA. Translation: AAU08232.1 .
    AF087860 mRNA. Translation: AAP97170.1 .
    AF498950 mRNA. Translation: AAM21098.1 .
    AF136974 mRNA. Translation: AAG49435.1 .
    AL136734 mRNA. Translation: CAB66668.1 .
    BT009840 mRNA. Translation: AAP88842.1 .
    CR533455 mRNA. Translation: CAG38486.1 .
    AK001555 mRNA. Translation: BAG50939.1 .
    AK295443 mRNA. Translation: BAH12069.1 .
    AK223153 mRNA. Translation: BAD96873.1 .
    AL138920 Genomic DNA. Translation: CAH70590.1 .
    CH471072 Genomic DNA. Translation: EAW86054.1 .
    CH471072 Genomic DNA. Translation: EAW86055.1 .
    BC015014 mRNA. Translation: AAH15014.1 .
    BC029350 mRNA. Translation: AAH29350.1 .
    CCDSi CCDS58073.1. [Q9NP72-3 ]
    CCDS7155.1. [Q9NP72-1 ]
    RefSeqi NP_001243339.1. NM_001256410.1. [Q9NP72-2 ]
    NP_001243340.1. NM_001256411.1.
    NP_001243341.1. NM_001256412.1. [Q9NP72-3 ]
    NP_001243344.1. NM_001256415.1.
    NP_067075.1. NM_021252.4. [Q9NP72-1 ]
    UniGenei Hs.406799.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1X3S X-ray 1.32 A 1-182 [» ]
    ProteinModelPortali Q9NP72.
    SMRi Q9NP72. Positions 2-178.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116591. 7 interactions.
    DIPi DIP-60514N.
    IntActi Q9NP72. 7 interactions.
    MINTi MINT-5003598.
    STRINGi 9606.ENSP00000349415.

    PTM databases

    PhosphoSitei Q9NP72.

    Polymorphism databases

    DMDMi 12230528.

    Proteomic databases

    MaxQBi Q9NP72.
    PaxDbi Q9NP72.
    PRIDEi Q9NP72.

    Protocols and materials databases

    DNASUi 22931.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356940 ; ENSP00000349415 ; ENSG00000099246 . [Q9NP72-1 ]
    ENST00000535776 ; ENSP00000439321 ; ENSG00000099246 . [Q9NP72-3 ]
    GeneIDi 22931.
    KEGGi hsa:22931.
    UCSCi uc001itv.4. human. [Q9NP72-1 ]
    uc001itw.4. human. [Q9NP72-2 ]
    uc010qdr.3. human.

    Organism-specific databases

    CTDi 22931.
    GeneCardsi GC10P027793.
    HGNCi HGNC:14244. RAB18.
    HPAi HPA025928.
    MIMi 602207. gene.
    614222. phenotype.
    neXtProti NX_Q9NP72.
    Orphaneti 2510. Micro syndrome.
    PharmGKBi PA34106.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000233968.
    HOVERGENi HBG009351.
    KOi K07910.
    OMAi TYTTRND.
    OrthoDBi EOG7CVQ04.
    PhylomeDBi Q9NP72.
    TreeFami TF313448.

    Miscellaneous databases

    ChiTaRSi RAB18. human.
    EvolutionaryTracei Q9NP72.
    GeneWikii RAB18.
    GenomeRNAii 22931.
    NextBioi 43659.
    PROi Q9NP72.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NP72.
    Bgeei Q9NP72.
    CleanExi HS_RAB18.
    Genevestigatori Q9NP72.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR027417. P-loop_NTPase.
    IPR025662. Sigma_54_int_dom_ATP-bd_1.
    IPR005225. Small_GTP-bd_dom.
    IPR001806. Small_GTPase.
    IPR003579. Small_GTPase_Rab_type.
    [Graphical view ]
    Pfami PF00071. Ras. 1 hit.
    [Graphical view ]
    PRINTSi PR00449. RASTRNSFRMNG.
    SMARTi SM00175. RAB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51419. RAB. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "In silico cloning of the human Rab18 gene."
      Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    2. "Isolation and characterisation of the human rab18 gene after stimulation of endothelial cells with histamine."
      Schaefer U., Seibold S., Schneider A., Neugebauer E.
      FEBS Lett. 466:148-154(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Cloning and characterization of a novel splice variant of human Rab18 gene (RAB18)."
      Dou T., Ji C., Gu S., Chen F., Xu J., Ye X., Ying K., Xie Y., Mao Y.
      DNA Seq. 16:230-234(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
    4. "Cloning and expression of a novel human cDNA homologous to murine ras-related protein (rab18) mRNA."
      Cui W.C., Yu L., Liu Q., Lin W., Han X.F., Zhao S.Y.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Puhl H.L. III, Ikeda S.R., Aronstam R.S.
      Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Adrenal gland.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    8. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    9. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Corpus callosum.
    11. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    12. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hippocampus and Skin.
    15. Bienvenut W.V., Waridel P., Quadroni M.
      Submitted (MAR-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 1-21; 59-69 AND 99-123, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Embryonic kidney.
    16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    18. "Crystal structure of human RAB18 in complex with GPPNHP."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (1.32 ANGSTROMS) OF 1-184 IN COMPLEX WITH GTP ANALOG.
    19. Cited for: VARIANTS WARBM3 GLN-24 AND ARG-93 DEL, FUNCTION.

    Entry informationi

    Entry nameiRAB18_HUMAN
    AccessioniPrimary (citable) accession number: Q9NP72
    Secondary accession number(s): B3KMC7
    , B7Z333, D3DRW1, Q53FX8, Q56UN9, Q6FIH1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 145 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3