SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NP72

- RAB18_HUMAN

UniProt

Q9NP72 - RAB18_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ras-related protein Rab-18
Gene
RAB18
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi15 – 239GTP
Nucleotide bindingi63 – 675GTP
Nucleotide bindingi122 – 1254GTP
Nucleotide bindingi151 – 1533GTP

GO - Molecular functioni

  1. GDP binding Source: UniProtKB
  2. GTP binding Source: UniProtKB-KW
  3. GTPase activity Source: UniProtKB
  4. protein binding Source: IntAct

GO - Biological processi

  1. GTP catabolic process Source: GOC
  2. brain development Source: UniProtKB
  3. eye development Source: UniProtKB
  4. lipid particle organization Source: MGI
  5. protein transport Source: UniProtKB-KW
  6. small GTPase mediated signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-18
Gene namesi
Name:RAB18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:14244. RAB18.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. intracellular Source: LIFEdb
  3. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Warburg micro syndrome 3 (WARBM3) [MIM:614222]: A rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → Q in WARBM3. 1 Publication
VAR_066495
Natural varianti93 – 931Missing in WARBM3. 1 Publication
VAR_066496

Organism-specific databases

MIMi614222. phenotype.
Orphaneti2510. Micro syndrome.
PharmGKBiPA34106.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 203203Ras-related protein Rab-18
PRO_0000121193Add
BLAST
Propeptidei204 – 2063Removed in mature form Reviewed prediction
PRO_0000370761

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications
Lipidationi199 – 1991S-palmitoyl cysteine Reviewed prediction
Modified residuei203 – 2031Cysteine methyl ester Reviewed prediction
Lipidationi203 – 2031S-geranylgeranyl cysteine By similarity

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Prenylation

Proteomic databases

MaxQBiQ9NP72.
PaxDbiQ9NP72.
PRIDEiQ9NP72.

PTM databases

PhosphoSiteiQ9NP72.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

ArrayExpressiQ9NP72.
BgeeiQ9NP72.
CleanExiHS_RAB18.
GenevestigatoriQ9NP72.

Organism-specific databases

HPAiHPA025928.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q99IB85EBI-722247,EBI-6927873From a different organism.

Protein-protein interaction databases

BioGridi116591. 7 interactions.
DIPiDIP-60514N.
IntActiQ9NP72. 7 interactions.
MINTiMINT-5003598.
STRINGi9606.ENSP00000349415.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi5 – 1410
Helixi21 – 3010
Beta strandi42 – 5211
Beta strandi55 – 6410
Helixi68 – 703
Helixi74 – 785
Beta strandi83 – 897
Helixi93 – 975
Helixi99 – 1068
Beta strandi116 – 1227
Beta strandi126 – 1283
Helixi133 – 14210
Beta strandi146 – 1494
Turni152 – 1543
Helixi158 – 17013
Helixi173 – 1753

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X3SX-ray1.32A1-182[»]
ProteinModelPortaliQ9NP72.
SMRiQ9NP72. Positions 2-178.

Miscellaneous databases

EvolutionaryTraceiQ9NP72.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi37 – 459Effector region By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1100.
HOGENOMiHOG000233968.
HOVERGENiHBG009351.
KOiK07910.
OMAiTYTTRND.
OrthoDBiEOG7CVQ04.
PhylomeDBiQ9NP72.
TreeFamiTF313448.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR025662. Sigma_54_int_dom_ATP-bd_1.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view]
PfamiPF00071. Ras. 1 hit.
[Graphical view]
PRINTSiPR00449. RASTRNSFRMNG.
SMARTiSM00175. RAB. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51419. RAB. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NP72-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDEDVLTTLK ILIIGESGVG KSSLLLRFTD DTFDPELAAT IGVDFKVKTI    50
SVDGNKAKLA IWDTAGQERF RTLTPSYYRG AQGVILVYDV TRRDTFVKLD 100
NWLNELETYC TRNDIVNMLV GNKIDKENRE VDRNEGLKFA RKHSMLFIEA 150
SAKTCDGVQC AFEELVEKII QTPGLWESEN QNKGVKLSHR EEGQGGGACG 200
GYCSVL 206
Length:206
Mass (Da):22,977
Last modified:October 1, 2000 - v1
Checksum:iD1B0F4866547DF77
GO
Isoform 2 (identifier: Q9NP72-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: W → WVTLHQQTANFFLKSQIGNSPILKWAMWQY

Note: Highly expressed in testis.

Show »
Length:235
Mass (Da):26,410
Checksum:i3E11FA232CFEDCFF
GO
Isoform 3 (identifier: Q9NP72-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-126: Missing.

Note: No experimental confirmation available.

Show »
Length:142
Mass (Da):15,508
Checksum:i9B8066F80314F7A0
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → Q in WARBM3. 1 Publication
VAR_066495
Natural varianti93 – 931Missing in WARBM3. 1 Publication
VAR_066496
Natural varianti113 – 1131N → S.
Corresponds to variant rs12268932 [ dbSNP | Ensembl ].
VAR_051713
Natural varianti198 – 1981A → T.
Corresponds to variant rs11015859 [ dbSNP | Ensembl ].
VAR_034432

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei62 – 621W → WVTLHQQTANFFLKSQIGNS PILKWAMWQY in isoform 2.
VSP_043912
Alternative sequencei63 – 12664Missing in isoform 3.
VSP_044883Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611I → L in BAD96873. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ277145
, AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA. Translation: CAB86486.1.
AF137372 mRNA. Translation: AAF61433.1.
AY574034 mRNA. Translation: AAU08232.1.
AF087860 mRNA. Translation: AAP97170.1.
AF498950 mRNA. Translation: AAM21098.1.
AF136974 mRNA. Translation: AAG49435.1.
AL136734 mRNA. Translation: CAB66668.1.
BT009840 mRNA. Translation: AAP88842.1.
CR533455 mRNA. Translation: CAG38486.1.
AK001555 mRNA. Translation: BAG50939.1.
AK295443 mRNA. Translation: BAH12069.1.
AK223153 mRNA. Translation: BAD96873.1.
AL138920 Genomic DNA. Translation: CAH70590.1.
CH471072 Genomic DNA. Translation: EAW86054.1.
CH471072 Genomic DNA. Translation: EAW86055.1.
BC015014 mRNA. Translation: AAH15014.1.
BC029350 mRNA. Translation: AAH29350.1.
CCDSiCCDS58073.1. [Q9NP72-3]
CCDS7155.1. [Q9NP72-1]
RefSeqiNP_001243339.1. NM_001256410.1. [Q9NP72-2]
NP_001243340.1. NM_001256411.1.
NP_001243341.1. NM_001256412.1. [Q9NP72-3]
NP_001243344.1. NM_001256415.1.
NP_067075.1. NM_021252.4. [Q9NP72-1]
UniGeneiHs.406799.

Genome annotation databases

EnsembliENST00000356940; ENSP00000349415; ENSG00000099246. [Q9NP72-1]
ENST00000535776; ENSP00000439321; ENSG00000099246. [Q9NP72-3]
GeneIDi22931.
KEGGihsa:22931.
UCSCiuc001itv.4. human. [Q9NP72-1]
uc001itw.4. human. [Q9NP72-2]
uc010qdr.3. human.

Polymorphism databases

DMDMi12230528.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ277145
, AJ277146 , AJ277147 , AJ277148 , AJ277149 Genomic DNA. Translation: CAB86486.1 .
AF137372 mRNA. Translation: AAF61433.1 .
AY574034 mRNA. Translation: AAU08232.1 .
AF087860 mRNA. Translation: AAP97170.1 .
AF498950 mRNA. Translation: AAM21098.1 .
AF136974 mRNA. Translation: AAG49435.1 .
AL136734 mRNA. Translation: CAB66668.1 .
BT009840 mRNA. Translation: AAP88842.1 .
CR533455 mRNA. Translation: CAG38486.1 .
AK001555 mRNA. Translation: BAG50939.1 .
AK295443 mRNA. Translation: BAH12069.1 .
AK223153 mRNA. Translation: BAD96873.1 .
AL138920 Genomic DNA. Translation: CAH70590.1 .
CH471072 Genomic DNA. Translation: EAW86054.1 .
CH471072 Genomic DNA. Translation: EAW86055.1 .
BC015014 mRNA. Translation: AAH15014.1 .
BC029350 mRNA. Translation: AAH29350.1 .
CCDSi CCDS58073.1. [Q9NP72-3 ]
CCDS7155.1. [Q9NP72-1 ]
RefSeqi NP_001243339.1. NM_001256410.1. [Q9NP72-2 ]
NP_001243340.1. NM_001256411.1.
NP_001243341.1. NM_001256412.1. [Q9NP72-3 ]
NP_001243344.1. NM_001256415.1.
NP_067075.1. NM_021252.4. [Q9NP72-1 ]
UniGenei Hs.406799.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1X3S X-ray 1.32 A 1-182 [» ]
ProteinModelPortali Q9NP72.
SMRi Q9NP72. Positions 2-178.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116591. 7 interactions.
DIPi DIP-60514N.
IntActi Q9NP72. 7 interactions.
MINTi MINT-5003598.
STRINGi 9606.ENSP00000349415.

PTM databases

PhosphoSitei Q9NP72.

Polymorphism databases

DMDMi 12230528.

Proteomic databases

MaxQBi Q9NP72.
PaxDbi Q9NP72.
PRIDEi Q9NP72.

Protocols and materials databases

DNASUi 22931.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000356940 ; ENSP00000349415 ; ENSG00000099246 . [Q9NP72-1 ]
ENST00000535776 ; ENSP00000439321 ; ENSG00000099246 . [Q9NP72-3 ]
GeneIDi 22931.
KEGGi hsa:22931.
UCSCi uc001itv.4. human. [Q9NP72-1 ]
uc001itw.4. human. [Q9NP72-2 ]
uc010qdr.3. human.

Organism-specific databases

CTDi 22931.
GeneCardsi GC10P027793.
HGNCi HGNC:14244. RAB18.
HPAi HPA025928.
MIMi 602207. gene.
614222. phenotype.
neXtProti NX_Q9NP72.
Orphaneti 2510. Micro syndrome.
PharmGKBi PA34106.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
HOGENOMi HOG000233968.
HOVERGENi HBG009351.
KOi K07910.
OMAi TYTTRND.
OrthoDBi EOG7CVQ04.
PhylomeDBi Q9NP72.
TreeFami TF313448.

Miscellaneous databases

ChiTaRSi RAB18. human.
EvolutionaryTracei Q9NP72.
GeneWikii RAB18.
GenomeRNAii 22931.
NextBioi 43659.
PROi Q9NP72.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NP72.
Bgeei Q9NP72.
CleanExi HS_RAB18.
Genevestigatori Q9NP72.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR027417. P-loop_NTPase.
IPR025662. Sigma_54_int_dom_ATP-bd_1.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR003579. Small_GTPase_Rab_type.
[Graphical view ]
Pfami PF00071. Ras. 1 hit.
[Graphical view ]
PRINTSi PR00449. RASTRNSFRMNG.
SMARTi SM00175. RAB. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51419. RAB. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "In silico cloning of the human Rab18 gene."
    Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. "Isolation and characterisation of the human rab18 gene after stimulation of endothelial cells with histamine."
    Schaefer U., Seibold S., Schneider A., Neugebauer E.
    FEBS Lett. 466:148-154(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning and characterization of a novel splice variant of human Rab18 gene (RAB18)."
    Dou T., Ji C., Gu S., Chen F., Xu J., Ye X., Ying K., Xie Y., Mao Y.
    DNA Seq. 16:230-234(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  4. "Cloning and expression of a novel human cDNA homologous to murine ras-related protein (rab18) mRNA."
    Cui W.C., Yu L., Liu Q., Lin W., Han X.F., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Puhl H.L. III, Ikeda S.R., Aronstam R.S.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adrenal gland.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  8. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Corpus callosum.
  11. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  12. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus and Skin.
  15. Bienvenut W.V., Waridel P., Quadroni M.
    Submitted (MAR-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1-21; 59-69 AND 99-123, ACETYLATION AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryonic kidney.
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "Crystal structure of human RAB18 in complex with GPPNHP."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.32 ANGSTROMS) OF 1-184 IN COMPLEX WITH GTP ANALOG.
  19. Cited for: VARIANTS WARBM3 GLN-24 AND ARG-93 DEL, FUNCTION.

Entry informationi

Entry nameiRAB18_HUMAN
AccessioniPrimary (citable) accession number: Q9NP72
Secondary accession number(s): B3KMC7
, B7Z333, D3DRW1, Q53FX8, Q56UN9, Q6FIH1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 1, 2000
Last modified: September 3, 2014
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi