Q9NNW7 (TRXR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Thioredoxin reductase 2, mitochondrial EC=1.8.1.9 Alternative name(s): Selenoprotein Z Short name=SelZ TR-beta Thioredoxin reductase TR3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Maintains thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling. |
| Catalytic activity | Thioredoxin + NADP+ = thioredoxin disulfide + NADPH. |
| Cofactor | FAD By similarity. |
| Subunit structure | Homodimer. UniProtKB P38816 |
| Subcellular location | |
| Tissue specificity | Highly expressed in the prostate, ovary, liver, testis, uterus, colon and small intestine. Intermediate levels in brain, skeletal muscle, heart and spleen. Low levels in placenta, pancreas, thymus and peripheral blood leukocytes. According to Ref.5, high levels in kidney, whereas according to Ref.2, levels are low. Ref.2 Ref.3 Ref.5 |
| Miscellaneous | The active site is a redox-active disulfide bond. The selenocysteine residue is essential for enzymatic activity By similarity. UniProtKB Q9Z0J5 |
| Sequence similarities | Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. |
| Sequence caution | The sequence AAD25167.1 differs from that shown. Reason: Erroneous initiation. The sequence AAG47635.1 differs from that shown. Reason: Erroneous termination at position 523. Translated as Sec. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism Selenocysteine |
| Domain | Redox-active center Transit peptide |
| Ligand | FAD Flavoprotein NADP |
| Molecular function | Oxidoreductase |
| PTM | Acetylation Disulfide bond |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell redox homeostasis Inferred from electronic annotation. Source: InterPro response to oxygen radicalTraceable author statement Ref.1. Source: UniProtKB |
| Cellular component | mitochondrion Inferred from direct assay Ref.3. Source: UniProtKB |
| Molecular function | NADP binding Inferred from electronic annotation. Source: InterPro flavin adenine dinucleotide bindingInferred from electronic annotation. Source: InterPro thioredoxin-disulfide reductase activityInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NNW7-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NNW7-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 1-30: MAAMAVALRGLGGRFRWRTQAVAGGVRGAA → MEDQ | ||||||
| Isoform 3 (identifier: Q9NNW7-3) Also known as: SelZf2; The sequence of this isoform differs from the canonical sequence as follows: 1-96: Missing. | ||||||
| Isoform 4 (identifier: Q9NNW7-4) Also known as: SelZf1; The sequence of this isoform differs from the canonical sequence as follows: 1-247: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 36 | 36 | Mitochondrion Potential | ||||||||
| Chain | 37 – 524 | 488 | Thioredoxin reductase 2, mitochondrial | PRO_0000030288 | |||||||
Regions | |||||||||||
| Nucleotide binding | 41 – 70 | 30 | FAD By similarity | ||||||||
Sites | |||||||||||
| Active site | 497 | 1 | Proton acceptor By similarity | ||||||||
Amino acid modifications | |||||||||||
| Non-standard residue | 523 | 1 | Selenocysteine | ||||||||
| Modified residue | 153 | 1 | N6-acetyllysine Ref.10 | ||||||||
| Disulfide bond | 86 ↔ 91 | Redox-active By similarity UniProtKB P00390 | |||||||||
| Cross-link | 522 ↔ 523 | Cysteinyl-selenocysteine (Cys-Sec) By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 247 | 247 | Missing in isoform 4. | VSP_008306 | |||||||
| Alternative sequence | 1 – 96 | 96 | Missing in isoform 3. | VSP_008305 | |||||||
| Alternative sequence | 1 – 30 | 30 | MAAMA…VRGAA → MEDQ in isoform 2. | VSP_008304 | |||||||
| Natural variant | 14 | 1 | R → L. Corresponds to variant rs45593642 [ dbSNP | Ensembl ]. | VAR_051777 | |||||||
| Natural variant | 66 | 1 | A → S. Ref.2 Ref.6 Ref.8 Corresponds to variant rs5748469 [ dbSNP | Ensembl ]. | VAR_051778 | |||||||
| Natural variant | 299 | 1 | S → R. Corresponds to variant rs5992495 [ dbSNP | Ensembl ]. | VAR_051779 | |||||||
| Natural variant | 370 | 1 | I → T. Ref.4 Ref.5 Ref.6 Corresponds to variant rs1139793 [ dbSNP | Ensembl ]. | VAR_051780 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 33 | 1 | Missing in AAG47635. Ref.6 | ||||||||
| Sequence conflict | 285 | 1 | R → K in AAG47635. Ref.6 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Redox regulation of cell signaling by selenocysteine in mammalian thioredoxin reductases." Sun Q.-A., Wu Y., Zappacosta F., Jeang K.-T., Lee B.J., Hatfield D.L., Gladyshev V.N. J. Biol. Chem. 274:24522-24530(1999) [PubMed: 10455115] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning, sequencing and functional expression of a novel human thioredoxin reductase." Gasdaska P.Y., Berggren M.M., Berry M.J., Powis G. FEBS Lett. 442:105-111(1999) [PubMed: 9923614] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT SER-66. Tissue: Fetal heart and Placenta. |
| [3] | "Human mitochondrial thioredoxin reductase: cDNA cloning, expression and genomic organization." Miranda-Vizuete A., Damdimopoulos A.E., Pedrajas J.R., Gustafsson J.-A., Spyrou G. Eur. J. Biochem. 261:405-412(1999) [PubMed: 10215850] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Adrenal gland and Testis. |
| [4] | Toji S., Yano M., Tamai K. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 2), VARIANT THR-370. |
| [5] | "Novel selenoproteins identified in silico and in vivo by using a conserved RNA structural motif." Lescure A., Gautheret D., Carbon P., Krol A. J. Biol. Chem. 274:38147-38154(1999) [PubMed: 10608886] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), ALTERNATIVE SPLICING, TISSUE SPECIFICITY, VARIANT THR-370. Tissue: Cervix carcinoma. |
| [6] | Kim J.-R., Lee Y.H., Lee S.-R., Kim B.H., Rhee S.G., Kim J.H. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1), VARIANTS SER-66 AND THR-370. |
| [7] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 40-524, VARIANT SER-66. Tissue: Skin. |
| [9] | "Heterogeneity within animal thioredoxin reductases: evidence for alternative first exon splicing." Sun Q.-A., Zappacosta F., Factor V.M., Wirth P.J., Hatfield D.L., Gladyshev V.N. J. Biol. Chem. 276:3106-3114(2001) [PubMed: 11060283] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [10] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-153, MASS SPECTROMETRY. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF171054 mRNA. Translation: AAD51324.1. AF106697 mRNA. Translation: AAD19597.1. AF044212 mRNA. Translation: AAD25167.1. Different initiation. AB019694 mRNA. Translation: BAA77601.2. AB019695 mRNA. Translation: BAA77602.2. AF166126 mRNA. Translation: AAF21431.1. AF166127 mRNA. Translation: AAF21432.1. AF201385 mRNA. Translation: AAG47635.1. Sequence problems. AC000078 Genomic DNA. No translation available. AC000080 Genomic DNA. No translation available. AC000090 Genomic DNA. No translation available. BC007489 mRNA. Translation: AAH07489.3. | ||||||||||||
| IPI | IPI00220566. IPI00883598. IPI01018202. IPI01021422. | ||||||||||||
| RefSeq | NP_006431.2. NM_006440.3. | ||||||||||||
| UniGene | Hs.443430. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9NNW7. | ||||||||||||
| SMR | Q9NNW7. Positions 37-518. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | Q9NNW7. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9NNW7. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 182705230. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9NNW7. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000400521; ENSP00000383365; ENSG00000184470. | ||||||||||||
| GeneID | 10587. | ||||||||||||
| KEGG | hsa:10587. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10587. | ||||||||||||
| GeneCards | GC22M019863. | ||||||||||||
| H-InvDB | HIX0016244. | ||||||||||||
| HGNC | HGNC:18155. TXNRD2. | ||||||||||||
| HPA | CAB002007. HPA003323. | ||||||||||||
| MIM | 606448. gene. | ||||||||||||
| neXtProt | NX_Q9NNW7. | ||||||||||||
| PharmGKB | PA38302. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000007578. | ||||||||||||
| HOVERGEN | HBG004959. | ||||||||||||
| InParanoid | Q9NNW7. | ||||||||||||
| OMA | VMRTVGI. | ||||||||||||
| PhylomeDB | Q9NNW7. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9NNW7. | ||||||||||||
| Bgee | Q9NNW7. | ||||||||||||
| Genevestigator | Q9NNW7. | ||||||||||||
| GermOnline | ENSG00000184470. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR016156. FAD/NAD-linked_Rdtase_dimer. IPR013027. FAD_pyr_nucl-diS_OxRdtase. IPR004099. Pyr_nucl-diS_OxRdtase_dimer. IPR023753. Pyr_nucl-diS_OxRdtase_FAD/NAD. IPR012999. Pyr_OxRdtase_I_AS. IPR001327. Pyr_OxRdtase_NAD-bd_dom. IPR006338. Thioredoxin/glutathione_Rdtase. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.390.30. Pyr_redox_dim. 1 hit. | ||||||||||||
| KO | K00384. | ||||||||||||
| PANTHER | PTHR22912:SF23. Reduct_Se. 1 hit. | ||||||||||||
| Pfam | PF00070. Pyr_redox. 1 hit. PF07992. Pyr_redox_2. 1 hit. PF02852. Pyr_redox_dim. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00368. FADPNR. | ||||||||||||
| SUPFAM | SSF55424. FAD/NAD-linked_reductase_dimer. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR01438. TGR. 1 hit. | ||||||||||||
| PROSITE | PS00076. PYRIDINE_REDOX_1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 40203. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | TRXR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NNW7 Secondary accession number(s): O95840 Q9UQU8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with