Q9NII1 (ADAR_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-specific editase Adar EC=3.5.-.- Alternative name(s): Adenosine deaminase that act on RNA Pre-mRNA adenosine deaminase RNA-editing deaminase 1 RNA-editing enzyme 1 dADAR dsRNA adenosine deaminase | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 676 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Has A-to-I RNA editing activity on extended dsRNA: edits RNA-binding protein Rnp4F. A-to-I editing of pre-mRNAs acts predominantly through nervous system targets to affect adult nervous system integrity, function and behavior. Essential for adaptation to environmental stresses, such as oxygen deprivation, and for the prevention of premature neuronal degeneration, through the editing of ion channels as targets. Ref.1 Ref.2 Ref.7 Ref.8 |
| Tissue specificity | Expressed in embryonic nervous system; late stage 13 sees ventral nerve cord expression which spreads to brain by stage 16. Expression is maintained through to adulthood. Ref.1 Ref.2 Ref.7 |
| Developmental stage | Expressed throughout development, highest expression is during pupal stage. Isoforms A, C and D have lowest expression levels. Ref.1 |
| Disruption phenotype | Adult flies are morphologically wild-type but exhibit extreme behavioral defects including temperature-sensitive paralysis, locomotor uncoordination, and tremors which increase in severity with age. Ref.7 |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRBM (double-stranded RNA-binding) domains. |
| RNA editing | Edited at position 437. |
| Sequence caution | The sequence AAM50022.1 differs from that shown. Reason: Intron retention. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform C Ref.1 (identifier: Q9NII1-1) Also known as: b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A Ref.1 (identifier: Q9NII1-2) Also known as: a; The sequence of this isoform differs from the canonical sequence as follows: 154-191: GIENLSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQN → D | ||||||
| Isoform B Ref.3 (identifier: Q9NII1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-19: MKFDSRVMLNSANNNSPQH → MTLCRYSE 154-191: GIENLSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQN → D | ||||||
| Isoform D Ref.1 (identifier: Q9NII1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-19: MKFDSRVMLNSANNNSPQH → MKFECFSLYCTVLK | ||||||
| Isoform F Ref.1 (identifier: Q9NII1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-28: Missing. | ||||||
| Isoform G Ref.1 (identifier: Q9NII1-6) The sequence of this isoform differs from the canonical sequence as follows: 1-28: Missing. 154-191: GIENLSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQN → D | ||||||
| Isoform E (identifier: Q9NII1-7) The sequence of this isoform differs from the canonical sequence as follows: 1-7: Missing. | ||||||
| Note: Produced by alternative initiation at Met-8 of isoform C. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 676 | 676 | Double-stranded RNA-specific editase Adar Ref.1 | PRO_0000004790 | |||||
Regions | |||||||||
| Domain | 61 – 127 | 67 | DRBM 1 | ||||||
| Domain | 197 – 272 | 76 | DRBM 2 | ||||||
| Domain | 348 – 672 | 325 | A to I editase | ||||||
Sites | |||||||||
| Active site | 374 | 1 | Proton donor By similarity UniProtKB P78563 | ||||||
| Metal binding | 372 | 1 | Zinc By similarity UniProtKB P78563 | ||||||
| Metal binding | 430 | 1 | Zinc By similarity UniProtKB P78563 | ||||||
| Metal binding | 493 | 1 | Zinc By similarity UniProtKB P78563 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 28 | 28 | Missing in isoform F and isoform G. Ref.1 | VSP_051650 | |||||
| Alternative sequence | 1 – 19 | 19 | MKFDS…NSPQH → MTLCRYSE in isoform B. Ref.3 | VSP_051649 | |||||
| Alternative sequence | 1 – 19 | 19 | MKFDS…NSPQH → MKFECFSLYCTVLK in isoform D. Ref.1 | VSP_051648 | |||||
| Alternative sequence | 1 – 7 | 7 | Missing in isoform E. | VSP_018700 | |||||
| Alternative sequence | 154 – 191 | 38 | GIENL…CMSQN → D in isoform A, isoform B and isoform G. Ref.1 Ref.3 | VSP_051651 | |||||
| Natural variant | 437 | 1 | S → G in RNA edited version. Ref.1 | ||||||
Experimental info | |||||||||
| Sequence conflict | 346 | 1 | V → VSPQPAKHCETNYNAKPILD QV in CAA22774. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "dADAR, a Drosophila double-stranded RNA-specific adenosine deaminase is highly developmentally regulated and is itself a target for RNA editing." Palladino M.J., Keegan L.P., O'Connell M.A., Reenan R.A. RNA 6:1004-1018(2000) [PubMed: 10917596] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS A; C; D; E; F AND G), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, RNA EDITING OF POSITION 437. Strain: Canton-S. |
| [2] | "Mutation in pre-mRNA adenosine deaminase markedly attenuates neuronal tolerance to O(2) deprivation in Drosophila melanogaster." Ma E., Gu X.-Q., Wu X., Xu T., Haddad G.G. J. Clin. Invest. 107:685-693(2001) [PubMed: 11254668] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, TISSUE SPECIFICITY. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "From sequence to chromosome: the tip of the X chromosome of D. melanogaster." Benos P.V., Gatt M.K., Ashburner M., Murphy L., Harris D., Barrell B.G., Ferraz C., Vidal S., Brun C., Demailles J., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Borkova D., Minana B. Glover D.M.Science 287:2220-2222(2000) [PubMed: 10731137] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Oregon-R. |
| [6] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: Berkeley. Tissue: Embryo. |
| [7] | "A-to-I pre-mRNA editing in Drosophila is primarily involved in adult nervous system function and integrity." Palladino M.J., Keegan L.P., O'Connell M.A., Reenan R.A. Cell 102:437-449(2000) [PubMed: 10966106] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [8] | "RNA editing and regulation of Drosophila 4f-rnp expression by sas-10 antisense readthrough mRNA transcripts." Peters N.T., Rohrbach J.A., Zalewski B.A., Byrkett C.M., Vaughn J.C. RNA 9:698-710(2003) [PubMed: 12756328] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF208535 Genomic DNA. Translation: AAF63702.1. AF208535 Genomic DNA. Translation: AAF63703.1. AF343579 mRNA. Translation: AAK26850.1. AE014298 Genomic DNA. Translation: AAF45665.2. AE014298 Genomic DNA. Translation: AAN09057.2. AL035207 Genomic DNA. Translation: CAA22774.1. AY118653 mRNA. Translation: AAM50022.1. Sequence problems. |
| RefSeq | NP_569940.2. NM_130584.2. NP_726761.2. NM_166903.1. |
| UniGene | Dm.5410. |
3D structure databases | |
| ProteinModelPortal | Q9NII1. |
| SMR | Q9NII1. Positions 23-277, 287-675. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9NII1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 31130. |
| KEGG | dme:Dmel_CG12598. |
Organism-specific databases | |
| CTD | 103. |
| FlyBase | FBgn0026086. Adar. |
Phylogenomic databases | |
| InParanoid | Q9NII1. |
| OrthoDB | EOG4VQ84C. |
| PhylomeDB | Q9NII1. |
Gene expression databases | |
| Bgee | Q9NII1. |
Family and domain databases | |
| InterPro | IPR002466. A_deamin. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like. [Graphical view] |
| Gene3D | G3DSA:3.30.160.20. dsRNA-bd-like. 2 hits. |
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 2 hits. [Graphical view] |
| SMART | SM00552. ADEAMc. 1 hit. SM00358. DSRM. 2 hits. [Graphical view] |
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50137. DS_RBD. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 772061. |
Entry information
| Entry name | ADAR_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9NII1 Secondary accession number(s): O96834 Q9W562 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with