Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent secretion activator

Gene

Cadps

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles. However, it probably also participates in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering.1 Publication

GO - Molecular functioni

GO - Biological processi

  • dense core granule exocytosis Source: InterPro
  • neurotransmitter secretion Source: FlyBase
  • positive regulation of calcium ion-dependent exocytosis Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • sensory perception of pain Source: FlyBase
  • synaptic transmission, glutamatergic Source: UniProtKB
  • synaptic vesicle exocytosis Source: UniProtKB
  • vesicle-mediated transport Source: FlyBase
Complete GO annotation...

Keywords - Biological processi

Exocytosis, Protein transport, Transport

Keywords - Ligandi

Calcium, Lipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent secretion activator
Alternative name(s):
Calcium-activated protein for secretion
Gene namesi
Name:CadpsImported
Synonyms:CapsImported
ORF Names:CG33653Imported
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 4

Organism-specific databases

FlyBaseiFBgn0053653. Cadps.

Subcellular locationi

  • Cytoplasmic vesicle membrane 1 Publication
  • Cell junctionsynapse 1 Publication

  • Note: Membrane-associated to vesicles. Restricted to all classes of presynaptic termini independent of the ratio of vesicular content (DCVs versus SVs). Found in all identified classes of peripheral and central synapses. In the CNS, it is highly enriched in the synapse-dense neuropil, which lacks cell bodies. Present in all synapses in the neuropil where it precisely colocalizes with other pansynaptic markers. Similarly abundant in all classes of neuromuscular junction (NMJ) termini, including type I, II, and III NMJs, where it localizes to all 3 bouton types. Expressed at similar levels in boutons which contain primarily small clear glutamatergic vesicles, as well as boutons very highly enriched in large DCVs. It appears that neither bouton class contains a pure population of either SVs or DCVs, but only differs dramatically in the relative abundance of the vesicular classes. Thus, the level of expression does not correlate with the abundance of DCVs. Clearly present presynaptically and colocalizes exclusively with presynaptic markers.

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • synapse Source: UniProtKB
  • synaptic vesicle Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Flies display locomotory deficits and complete embryonic lethality. The mutant NMJ reveals a 50% loss in evoked glutamatergic transmission, and an accumulation of synaptic vesicles at active zones. They also display a 3-fold accumulation of DCVs in synaptic terminals.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538721 – 1447Calcium-dependent secretion activatorAdd BLAST1447

Proteomic databases

PaxDbiQ9NHE5.
PRIDEiQ9NHE5.

Expressioni

Tissue specificityi

Restricted to the nervous system at all stages of development and highly localized at synapses (at protein level).1 Publication

Developmental stagei

Not detected in early embryos through stage 8. Strongly expressed in neural-specific cells at the onset of early stages of neuronal differentiation beginning at stage 9-10. Accumulates from stage 12 through the rest of embryogenesis in all neuronal cells within the brain and ventral nerve cord (VNC). Remains restricted to the central nervous system and not detected in other tissues at any stage of development.1 Publication

Gene expression databases

BgeeiFBgn0053653.
ExpressionAtlasiQ9NHE5. baseline.
GenevisibleiQ9NHE5. DM.

Interactioni

Protein-protein interaction databases

STRINGi7227.FBpp0298334.

Structurei

3D structure databases

ProteinModelPortaliQ9NHE5.
SMRiQ9NHE5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini470 – 533C2Add BLAST64
Domaini573 – 683PHPROSITE-ProRule annotationAdd BLAST111
Domaini970 – 1157MHD1PROSITE-ProRule annotationAdd BLAST188

Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Sequence similaritiesi

Contains 1 C2 domain.Curated
Contains 1 MHD1 (MUNC13 homology domain 1) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
InParanoidiQ9NHE5.
KOiK19933.
OMAiNQAPPAR.
OrthoDBiEOG091G00HB.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 3 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NHE5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIDPSSSEEE GEDDAVPNVS SKGRLTNTTK GTSAVSIIGG SAGSVVGSNI
60 70 80 90 100
PVSGSNTDLI GNQRQSNISS ICNRNDVGNI SVAALGSTSN KIEQICGNRA
110 120 130 140 150
DTGNLEVPSN GIPSGISQET LNQSVGSSRA NSLPRPLSPS PSLTSEKHET
160 170 180 190 200
AEPHGKHERE EEERKRRIQL YVFISRCISY PFNAKQPTDM TKRQTKISKQ
210 220 230 240 250
QLEIITQRFQ AFLKGETQIM ADEAFQNAVQ SYHDVFLKSE RVLKMVQSGA
260 270 280 290 300
SSQHDFREVF RNNIEKRVRS LPEIDGLSKE TVLTSWMAKF DIILKGTGEE
310 320 330 340 350
DSKRPSRMQQ SLNSELILSK EQLYDMFQQI LLVKKFEHQI LFNALMLDSA
360 370 380 390 400
DEQAAAIRRE LDGRMQRVGE MEKNRKLMPK FVLKEMESLY VEELKSSINL
410 420 430 440 450
LMANLESLPV SKGNMDSKYG LQKLKRYNHS TPSFLKLILR SHGSLSKLEG
460 470 480 490 500
DSEDGSTQLT KLDVVLTFQL EVIVMEVENG EKLQTDQAEA SKPMWDTQGD
510 520 530 540 550
FTTTHPLPVV KVKLYTENPG MLALEDKELG KVTLKPTPLS SKSPEWHRMI
560 570 580 590 600
VPKNLPDQDI RIKIACRLDK PLNMKHCGYL YAIGKSVWKK WKRRYFVLVQ
610 620 630 640 650
VSQYTFAMCS YKEKKSEPSE MMQLDGYTVD YIEAASANLM FGIDLNGGRY
660 670 680 690 700
FFNAVREGDS ISFACDDENE CSLWVMAMYR ATGQSHKPTP PITQDKNSAM
710 720 730 740 750
SKIQGDADKA RKHGMEDFIS TDPCTFDHAT LFKTLQNLTL EYRLNDPYAS
760 770 780 790 800
LGWFSPGQVF VLDEYCARYG VRGCYRHLCY LSDLLDRAEK QHMIDPTLIH
810 820 830 840 850
YSFAFCASHV HGNRPDGVGS ITHEEKEKFS EIKERLRQLL EFQITNFRYC
860 870 880 890 900
FPFGRPEGAL KATLSLLERV LMKDIVTPVP PEEVRQMIKK SLETAALVNY
910 920 930 940 950
TRLSNKAKID EDLRGDVIVP APKKLEDLIH LAELCVDLLQ QNEEHYGEAF
960 970 980 990 1000
AWFSDLLVEH AEIFWSLFAV DMDRVLSEQA PDTWDSFPLF QILNDYLRTD
1010 1020 1030 1040 1050
DNLRNGRFHQ HLRDTFAPLV VRYVDLMESS IAQSIHKGFE KERWESKGIN
1060 1070 1080 1090 1100
AALNPAALNN AAQALNTAAL NPSMILCGKK DQVNFYVPKL PKQSNSTAAN
1110 1120 1130 1140 1150
DEMRNGCATS EDLFWKLDAL QSFIRDLHWP DAEFRQHLEQ RLKMMAVDMI
1160 1170 1180 1190 1200
EQCIQRTDSS FQSWLKKNIA FISTDYILPS EMCAMVNVIL DAKNQSFKLT
1210 1220 1230 1240 1250
TIDGIDLYKF HAKIDDQIDK ANVAMTQGLS GKLMSVLEST LSKLARYDEG
1260 1270 1280 1290 1300
SLIGSILSFT NVSSSGKDLG QGYVNFFRNN MDQVRGKIAD DLWTLHFFEQ
1310 1320 1330 1340 1350
WYSQQINMLC NWLSERVDHA LHYAQVASIS HIIKKIYSDF ELQGVLEDKL
1360 1370 1380 1390 1400
NSKAYQAVAQ RMATEEATCA LTMPDACEDE PCDEIREGEE EDNGDESTSN
1410 1420 1430 1440
IPRGLPKPKV AAAQAAAVTN VVAGRVGNLL GKGIGGLSSK LGSGSWF
Length:1,447
Mass (Da):163,110
Last modified:September 18, 2013 - v3
Checksum:i406B95DC0ECEE996
GO
Isoform 2 (identifier: Q9NHE5-2) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT

Show »
Length:1,534
Mass (Da):172,589
Checksum:iFAEC538101F31CC6
GO
Isoform 3 (identifier: Q9NHE5-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-463: Missing.
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT
     1001-1053: DNLRNGRFHQ...WESKGINAAL → APTQAPLSAT...LFSKPTRIAP
     1054-1447: Missing.

Note: Incomplete sequence.
Show »
Length:677
Mass (Da):76,634
Checksum:i1C7A497136561B0F
GO
Isoform 4 (identifier: Q9NHE5-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     477-478: Missing.

Note: No experimental confirmation available.
Show »
Length:1,445
Mass (Da):162,882
Checksum:i9146A557098B2AAC
GO
Isoform 5 (identifier: Q9NHE5-5) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     430-435: STPSFL → R
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT

Note: No experimental confirmation available.
Show »
Length:1,529
Mass (Da):172,113
Checksum:i90516BA213153A91
GO
Isoform 6 (identifier: Q9NHE5-6) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     705-705: Missing.
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT
     1049-1104: Missing.

Note: No experimental confirmation available.
Show »
Length:1,477
Mass (Da):166,622
Checksum:iCCB2F97873EF3EC5
GO
Isoform 7 (identifier: Q9NHE5-7) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     1049-1104: Missing.

Note: No experimental confirmation available.
Show »
Length:1,409
Mass (Da):159,205
Checksum:i42A765A91A2DF5F7
GO

Sequence cautioni

The sequence AAD38612 differs from that shown.Curated
The sequence AAF34697 differs from that shown. Reason: Frameshift at positions 1283 and 1411.Curated
The sequence AAM48456 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33S → N in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti153P → Q in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti164R → S in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti168 – 171IQLY → NSTL in AAF34697 (PubMed:11516399).Curated4
Sequence conflicti195T → K in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti204I → N in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti1234M → V in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti1354 – 1358AYQAV → DIRQ in AAF34697 (PubMed:11516399).Curated5

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0479121 – 463Missing in isoform 3. 1 PublicationAdd BLAST463
Alternative sequenceiVSP_047913430 – 435STPSFL → R in isoform 5. Curated6
Alternative sequenceiVSP_047914477 – 478Missing in isoform 4. Curated2
Alternative sequenceiVSP_047915477V → VKGLKSLAPNRIVYCTMEV in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 2 Publications1
Alternative sequenceiVSP_047916705Missing in isoform 6. Curated1
Alternative sequenceiVSP_047917948E → ELRKHDKMDKKKLLKEDEDV SGGHNESEVDLIDSTGLISA SELATAASTDGSSFRYCMPT HAVYTPPVPT in isoform 2, isoform 3, isoform 5 and isoform 6. 2 Publications1
Alternative sequenceiVSP_0479181001 – 1053DNLRN…INAAL → APTQAPLSATTTGAIPTARS TSGWVRVHQGTAPLTPSKTN PEVLFSKPTRIAP in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_0479191049 – 1104Missing in isoform 6 and isoform 7. CuratedAdd BLAST56
Alternative sequenceiVSP_0479201054 – 1447Missing in isoform 3. 1 PublicationAdd BLAST394

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF223578 mRNA. Translation: AAF34697.1. Frameshift.
AE014135 Genomic DNA. Translation: AAN06590.4.
AE014135 Genomic DNA. Translation: AAN06591.4.
AE014135 Genomic DNA. Translation: AAZ52485.2.
AE014135 Genomic DNA. Translation: AFH06799.1.
AE014135 Genomic DNA. Translation: AFH06800.1.
AY118427 mRNA. Translation: AAM48456.1. Different initiation.
AF145637 mRNA. Translation: AAD38612.1. Sequence problems.
RefSeqiNP_001027029.2. NM_001031858.2. [Q9NHE5-7]
NP_001027030.1. NM_001031859.2. [Q9NHE5-4]
NP_001027031.1. NM_001031860.2. [Q9NHE5-5]
NP_001245439.1. NM_001258510.2. [Q9NHE5-2]
NP_001245440.1. NM_001258511.2. [Q9NHE5-6]
UniGeneiDm.6976.

Genome annotation databases

GeneIDi49968.
KEGGidme:Dmel_CG33653.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF223578 mRNA. Translation: AAF34697.1. Frameshift.
AE014135 Genomic DNA. Translation: AAN06590.4.
AE014135 Genomic DNA. Translation: AAN06591.4.
AE014135 Genomic DNA. Translation: AAZ52485.2.
AE014135 Genomic DNA. Translation: AFH06799.1.
AE014135 Genomic DNA. Translation: AFH06800.1.
AY118427 mRNA. Translation: AAM48456.1. Different initiation.
AF145637 mRNA. Translation: AAD38612.1. Sequence problems.
RefSeqiNP_001027029.2. NM_001031858.2. [Q9NHE5-7]
NP_001027030.1. NM_001031859.2. [Q9NHE5-4]
NP_001027031.1. NM_001031860.2. [Q9NHE5-5]
NP_001245439.1. NM_001258510.2. [Q9NHE5-2]
NP_001245440.1. NM_001258511.2. [Q9NHE5-6]
UniGeneiDm.6976.

3D structure databases

ProteinModelPortaliQ9NHE5.
SMRiQ9NHE5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7227.FBpp0298334.

Proteomic databases

PaxDbiQ9NHE5.
PRIDEiQ9NHE5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi49968.
KEGGidme:Dmel_CG33653.

Organism-specific databases

CTDi8618.
FlyBaseiFBgn0053653. Cadps.

Phylogenomic databases

eggNOGiKOG3543. Eukaryota.
ENOG410Y0FD. LUCA.
InParanoidiQ9NHE5.
KOiK19933.
OMAiNQAPPAR.
OrthoDBiEOG091G00HB.

Miscellaneous databases

ChiTaRSiCaps. fly.
GenomeRNAii49968.
PROiQ9NHE5.

Gene expression databases

BgeeiFBgn0053653.
ExpressionAtlasiQ9NHE5. baseline.
GenevisibleiQ9NHE5. DM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR033227. CAPS.
IPR010439. CAPS_dom.
IPR014770. Munc13_1.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12166. PTHR12166. 3 hits.
PfamiPF06292. DUF1041. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM01145. DUF1041. 1 hit.
SM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS51258. MHD1. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAPS_DROME
AccessioniPrimary (citable) accession number: Q9NHE5
Secondary accession number(s): H9XVQ4
, H9XVQ5, Q4AB01, Q5LJP1, Q8IM88, Q8IM89, Q8MT21, Q9Y135
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: September 18, 2013
Last modified: November 30, 2016
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.