Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-1

Gene

CACNB1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

GO - Molecular functioni

  • calcium channel activity Source: UniProtKB
  • high voltage-gated calcium channel activity Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-1
Short name:
CAB1
Alternative name(s):
Calcium channel voltage-dependent subunit beta 1
Gene namesi
Name:CACNB1
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Unplaced

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 598598Voltage-dependent L-type calcium channel subunit beta-1PRO_0000144045Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei44 – 441PhosphoserineBy similarity
Modified residuei47 – 471PhosphoserineBy similarity
Modified residuei73 – 731PhosphoserineBy similarity
Modified residuei186 – 1861PhosphoserineBy similarity
Modified residuei193 – 1931PhosphoserineBy similarity
Modified residuei499 – 4991PhosphothreonineBy similarity
Modified residuei547 – 5471PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9MZL7.
PRIDEiQ9MZL7.

Expressioni

Gene expression databases

BgeeiENSBTAG00000002036.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with JSRP1. Interacts with RYR1. Interacts with CBARP (By similarity).By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000040778.

Structurei

3D structure databases

ProteinModelPortaliQ9MZL7.
SMRiQ9MZL7. Positions 74-417.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini100 – 16162SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ9MZL7.
KOiK04862.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9MZL7-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1B, CACNB1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQKTSMSRG PYPSSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT
60 70 80 90 100
SNSFVRQGSA ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP
110 120 130 140 150
VAFAVRTNVG YNPSPGDEVP VQGVAITFEP KDFLHIKEKY NNDWWIGRLV
160 170 180 190 200
KEGCEVGFIP SPVKLDSLRL LQEQKLRQNR LSSSKSGDNS SSSLGDVVTG
210 220 230 240 250
TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK GYEVTDMMQK
260 270 280 290 300
ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
310 320 330 340 350
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK
360 370 380 390 400
VLQRLIKSRG KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH
410 420 430 440 450
LAEYLEAYWK ATHPPSSTPP NPLLNRTMAT AALAASPAPV SNLQGPYLAS
460 470 480 490 500
GDQSLERATG EHASVHEYPG ELGQPPGLYP SSHPPGRAGT LRALSRQDTF
510 520 530 540 550
DADTPGNRNS AYTELGDSCV DMETDPSEGP GLGDPAGGST PPARQGSWED
560 570 580 590
EEEDYEEELT DNRNRGRNKA RYCAEGGGPV LGRNKNELEG WGRGVYIR
Length:598
Mass (Da):65,749
Last modified:October 1, 2000 - v1
Checksum:i9DBD44364C96B823
GO
Isoform 2 (identifier: Q9MZL7-2) [UniParc]FASTAAdd to basket
Also known as: Beta-1C, CACNB1C

The sequence of this isoform differs from the canonical sequence as follows:
     445-478: GPYLASGDQSLERATGEHASVHEYPGELGQPPGL → VQVLTSLRRNLSFWGGLEASQRARAVPQQQEHTV
     479-598: Missing.

Show »
Length:478
Mass (Da):53,092
Checksum:i8243DEDDABB3AC59
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei445 – 47834GPYLA…QPPGL → VQVLTSLRRNLSFWGGLEAS QRARAVPQQQEHTV in isoform 2. 1 PublicationVSP_000621Add
BLAST
Alternative sequencei479 – 598120Missing in isoform 2. 1 PublicationVSP_000622Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174415 mRNA. Translation: AAF26679.1.
AF174416 mRNA. Translation: AAF26680.1.
RefSeqiNP_787013.1. NM_175819.2. [Q9MZL7-1]
UniGeneiBt.37145.

Genome annotation databases

GeneIDi327703.
KEGGibta:327703.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174415 mRNA. Translation: AAF26679.1.
AF174416 mRNA. Translation: AAF26680.1.
RefSeqiNP_787013.1. NM_175819.2. [Q9MZL7-1]
UniGeneiBt.37145.

3D structure databases

ProteinModelPortaliQ9MZL7.
SMRiQ9MZL7. Positions 74-417.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000040778.

Proteomic databases

PaxDbiQ9MZL7.
PRIDEiQ9MZL7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi327703.
KEGGibta:327703.

Organism-specific databases

CTDi782.

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ9MZL7.
KOiK04862.

Gene expression databases

BgeeiENSBTAG00000002036.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005443. VDCC_L_b1su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01627. LCACHANNELB1.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCACB1_BOVIN
AccessioniPrimary (citable) accession number: Q9MZL7
Secondary accession number(s): Q9MZL6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: October 1, 2000
Last modified: September 7, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.