Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 11

Gene

SPAG11

Organism
Pan troglodytes (Chimpanzee)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Protein inferred from homologyi

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 11
Alternative name(s):
EP2 protein
Gene namesi
Name:SPAG11
Synonyms:EP2
OrganismiPan troglodytes (Chimpanzee)
Taxonomic identifieri9598 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaePan
Proteomesi
  • UP000002277 Componenti: Chromosome 8

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence analysisAdd
BLAST
Chaini25 – 10379Sperm-associated antigen 11PRO_0000033186Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi29 – 291N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9MZ28.

Interactioni

Protein-protein interaction databases

STRINGi9598.ENSPTRP00000055544.

Structurei

3D structure databases

ProteinModelPortaliQ9MZ28.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SPAG11 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410JFGU. Eukaryota.
ENOG4111B8J. LUCA.
GeneTreeiENSGT00840000130147.
HOGENOMiHOG000266967.
HOVERGENiHBG073275.
InParanoidiQ9MZ28.
OMAiNCKRSEG.
OrthoDBiEOG7SXW5C.
TreeFamiTF338214.

Family and domain databases

InterProiIPR007988. Sperm_Ag_HE2.
[Graphical view]
PfamiPF05324. Sperm_Ag_HE2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform EP2A (identifier: Q9MZ28-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQRLLPSVT SLLLVALLFP GSSQARHVNH SATEALGELR ERAPGQGTNG
60 70 80 90 100
FQLLRHAVKR DLLPPRTPPY QVHISHQEAR GPSFKICVGF LGPRWARGCS

TGN
Length:103
Mass (Da):11,317
Last modified:February 28, 2003 - v2
Checksum:iABDD0D637854A81C
GO
Isoform EP2B (identifier: Q9MZ28-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MRQRLLPSVT...LLPPRTPPYQ → MKVFFLFAVLFCLVQTNS

Show »
Length:50
Mass (Da):5,559
Checksum:iA9165132432DCE1E
GO
Isoform EP2C (identifier: Q9MZ28-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-103: VHISHQEARGPSFKICVGFLGPRWARGCSTGN → EPASDLKVVDFRRSEGFCQEYCNYMETQVGYCPKKKDACCLH

Show »
Length:113
Mass (Da):12,741
Checksum:i8E111B17664352A6
GO
Isoform EP2D (identifier: Q9MZ28-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-103: VHISHQEARGPSFKICVGFLGPRWARGCSTGN → GDVPLGIRNT...KPEMDGRSGI

Show »
Length:133
Mass (Da):14,866
Checksum:iB8CB440910F9651A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171MRQRL…TPPYQ → MKVFFLFAVLFCLVQTNS in isoform EP2B. CuratedVSP_006214Add
BLAST
Alternative sequencei72 – 10332VHISH…CSTGN → EPASDLKVVDFRRSEGFCQE YCNYMETQVGYCPKKKDACC LH in isoform EP2C. CuratedVSP_006215Add
BLAST
Alternative sequencei72 – 10332VHISH…CSTGN → GDVPLGIRNTICRMQQGICR LFFCHSGEKKRDICSDPWNR CCVSNTDEEGKEKPEMDGRS GI in isoform EP2D. CuratedVSP_006216Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF263551 mRNA. Translation: AAF87718.1.
AF263552 mRNA. Translation: AAF87719.1.
AF263553 mRNA. Translation: AAF87720.1.
AF263554 mRNA. Translation: AAF87721.1.
RefSeqiNP_001103705.1. NM_001110235.1. [Q9MZ28-1]
NP_001103706.1. NM_001110236.1. [Q9MZ28-2]
NP_001103707.1. NM_001110237.1. [Q9MZ28-3]
NP_001103708.1. NM_001110238.1. [Q9MZ28-4]
UniGeneiPtr.6533.

Genome annotation databases

EnsembliENSPTRT00000037003; ENSPTRP00000034197; ENSPTRG00000019963. [Q9MZ28-3]
ENSPTRT00000043595; ENSPTRP00000039008; ENSPTRG00000019963. [Q9MZ28-2]
ENSPTRT00000047238; ENSPTRP00000046551; ENSPTRG00000019963. [Q9MZ28-1]
ENSPTRT00000063999; ENSPTRP00000055544; ENSPTRG00000019963. [Q9MZ28-4]
GeneIDi450159.
KEGGiptr:450159.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF263551 mRNA. Translation: AAF87718.1.
AF263552 mRNA. Translation: AAF87719.1.
AF263553 mRNA. Translation: AAF87720.1.
AF263554 mRNA. Translation: AAF87721.1.
RefSeqiNP_001103705.1. NM_001110235.1. [Q9MZ28-1]
NP_001103706.1. NM_001110236.1. [Q9MZ28-2]
NP_001103707.1. NM_001110237.1. [Q9MZ28-3]
NP_001103708.1. NM_001110238.1. [Q9MZ28-4]
UniGeneiPtr.6533.

3D structure databases

ProteinModelPortaliQ9MZ28.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9598.ENSPTRP00000055544.

Proteomic databases

PaxDbiQ9MZ28.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSPTRT00000037003; ENSPTRP00000034197; ENSPTRG00000019963. [Q9MZ28-3]
ENSPTRT00000043595; ENSPTRP00000039008; ENSPTRG00000019963. [Q9MZ28-2]
ENSPTRT00000047238; ENSPTRP00000046551; ENSPTRG00000019963. [Q9MZ28-1]
ENSPTRT00000063999; ENSPTRP00000055544; ENSPTRG00000019963. [Q9MZ28-4]
GeneIDi450159.
KEGGiptr:450159.

Organism-specific databases

CTDi10407.

Phylogenomic databases

eggNOGiENOG410JFGU. Eukaryota.
ENOG4111B8J. LUCA.
GeneTreeiENSGT00840000130147.
HOGENOMiHOG000266967.
HOVERGENiHBG073275.
InParanoidiQ9MZ28.
OMAiNCKRSEG.
OrthoDBiEOG7SXW5C.
TreeFamiTF338214.

Family and domain databases

InterProiIPR007988. Sperm_Ag_HE2.
[Graphical view]
PfamiPF05324. Sperm_Ag_HE2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Multiple promoter and splicing mRNA variants of the epididymis-specific gene EP2."
    Frohlich O., Po C., Murphy T., Young L.G.
    J. Androl. 21:421-430(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Entry informationi

Entry nameiSPG11_PANTR
AccessioniPrimary (citable) accession number: Q9MZ28
Secondary accession number(s): Q9MZ27, Q9MZ29
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: February 28, 2003
Last modified: June 8, 2016
This is version 80 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.