Reviewed,
UniProtKB/Swiss-Prot Q9M5K2 (DLDH2_ARATH)
Last modified
June 16, 2009.
Version 55.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Dihydrolipoyl dehydrogenase 2, mitochondrial EC=1.8.1.4 Alternative name(s): Dihydrolipoamide dehydrogenase 2 Pyruvate dehydrogenase complex E3 subunit 2 Short name=PDC-E3 2 Short name=E3-2 Glycine cleavage system L protein 2 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › eurosids II › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 507 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Lipoamide dehydrogenase is a component of the glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes. The pyruvate dehydrogenase complex contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). Ref.1 Ref.7 |
| Catalytic activity | Protein N(6)-(dihydrolipoyl)lysine + NAD+ = protein N(6)-(lipoyl)lysine + NADH. |
| Cofactor | Binds 1 FAD per subunit By similarity. |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | |
| Tissue specificity | Preferentially expressed in roots, flowers and siliques and at a lower level in stems and leaves. Ref.1 |
| Miscellaneous | The active site is a redox-active disulfide bond. |
| Sequence similarities | Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Redox-active center Transit peptide |
| Ligand | FAD Flavoprotein NAD |
| Molecular function | Oxidoreductase |
| PTM | Disulfide bond |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell redox homeostasis Inferred from electronic annotation. Source: InterPro oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW response to cadmium ionInferred from expression pattern. Source: TAIR |
| Cellular component | chloroplast Inferred from direct assay. Source: TAIR mitochondrial matrixInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from direct assay. Source: TAIR FAD bindingInferred from electronic annotation. Source: InterPro dihydrolipoyl dehydrogenase activityInferred from mutant phenotype. Source: TAIR protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9M5K2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9M5K2-2) The sequence of this isoform differs from the canonical sequence as follows: 92-127: ALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQ → VILETPFPITLIRRKFSPIFIRLLWNLLVDHHLDSI 128-507: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 36 | 36 | Mitochondrion Potential | ||||||||
| Chain | 37 – 507 | 471 | Dihydrolipoyl dehydrogenase 2, mitochondrial | PRO_0000260230 | |||||||
Regions | |||||||||||
| Nucleotide binding | 73 – 82 | 10 | FAD By similarity | ||||||||
| Nucleotide binding | 184 – 186 | 3 | FAD By similarity | ||||||||
| Nucleotide binding | 221 – 228 | 8 | NAD By similarity | ||||||||
| Nucleotide binding | 360 – 363 | 4 | FAD By similarity | ||||||||
Sites | |||||||||||
| Active site | 486 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 91 | 1 | FAD By similarity | ||||||||
| Binding site | 155 | 1 | FAD; via amide nitrogen and carbonyl oxygen By similarity | ||||||||
| Binding site | 244 | 1 | NAD By similarity | ||||||||
| Binding site | 278 | 1 | NAD; via amide nitrogen and carbonyl oxygen By similarity | ||||||||
| Binding site | 313 | 1 | NAD; via amide nitrogen By similarity | ||||||||
| Binding site | 354 | 1 | FAD By similarity | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 82 ↔ 87 | Redox-active By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 92 – 127 | 36 | ALLHS…AMLAQ → VILETPFPITLIRRKFSPIF IRLLWNLLVDHHLDSI in isoform 2. | VSP_021588 | |||||||
| Alternative sequence | 128 – 507 | 380 | Missing in isoform 2. | VSP_021589 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of two cDNAs encoding mitochondrial lipoamide dehydrogenase from Arabidopsis." Lutziger I., Oliver D.J. Plant Physiol. 127:615-623(2001) [PubMed: 11598235] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones." Sato S., Nakamura Y., Kaneko T., Katoh T., Asamizu E., Tabata S. DNA Res. 7:131-135(2000) [PubMed: 10819329] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | "Arabidopsis ORF clones." Shinn P., Chen H., Kim C.J., Ecker J.R. Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: cv. Columbia. |
| [4] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Cloning and characterization of 2-oxoglutarate dehydrogenase from Arabidopsis thaliana." Machuy N., Klein M., Mueller-Roeber B. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 36-507 (ISOFORM 1). Strain: cv. Columbia. |
| [6] | "Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins." Heazlewood J.L., Tonti-Filippini J.S., Gout A.M., Day D.A., Whelan J., Millar A.H. Plant Cell 16:241-256(2004) [PubMed: 14671022] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. |
| [7] | "Lipoic acid-dependent oxidative catabolism of alpha-keto acids in mitochondria provides evidence for branched-chain amino acid catabolism in Arabidopsis." Taylor N.L., Heazlewood J.L., Day D.A., Millar A.H. Plant Physiol. 134:838-848(2004) [PubMed: 14764908] [Abstract] Cited for: FUNCTION. |
Cross-references
Sequence databases | |
|---|---|
| AF228640 mRNA. Translation: AAF34796.1. AB022216 Genomic DNA. No translation available. BT024578 mRNA. Translation: ABD38917.1. AY087203 mRNA. Translation: AAM64759.1. AJ223804 mRNA. Translation: CAA11554.1. | |
| IPI | IPI00519283. IPI00522612. |
| RefSeq | NP_566570.3. NP_851005.1. |
| UniGene | At.20793 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1DXL based on UniProtKB P31023. |
| SMR | Q9M5K2. Positions 41-507. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9M5K2. 1 interaction. |
Proteomic databases | |
| PRIDE | Q9M5K2. |
Genome annotation databases | |
| GeneID | 820984. |
| GenomeReviews | Gene locus AT3G17240 in contig BA000014_GR. |
| KEGG | ath:AT3G17240. |
| NMPDR | fig|3702.1.peg.13912. |
Organism-specific databases | |
| GeneFarm | 4375. 442. |
| TAIR | At3g17240. |
Phylogenomic databases | |
| OMA | Q9M5K2. RILVNER. |
Enzyme and pathway databases | |
| BRENDA | 1.8.1.4. 302. |
Gene expression databases | |
| GermOnline | AT3G17240. Arabidopsis thaliana. |
Family and domain databases | |
| InterPro | IPR013027. FAD_pyr_nucl-diS_OxRdtase. IPR000815. Hg_reductase. IPR006258. Lipoamide_DH. IPR004099. Pyr_nucl-diS_OxRdtase_dimer. IPR012999. Pyr_OxRdtase_I_AS. IPR001327. Pyr_OxRdtase_NAD_bd. [Graphical view] |
| Gene3D | G3DSA:3.30.390.30. Pyr_redox_dim. 1 hit. |
| PANTHER | PTHR22912:SF20. Lipoamide_DH. 1 hit. |
| Pfam | PF00070. Pyr_redox. 1 hit. PF07992. Pyr_redox_2. 1 hit. PF02852. Pyr_redox_dim. 1 hit. [Graphical view] |
| PRINTS | PR00368. FADPNR. PR00945. HGRDTASE. |
| ProDom | PD000139. FAD_pyr_redox. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| TIGRFAMs | TIGR01350. lipoamide_DH. 1 hit. |
| PROSITE | PS00076. PYRIDINE_REDOX_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | DLDH2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9M5K2 Secondary accession number(s): Q8LBH6, Q9ZRQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with


