Q9M5K2 (DLDH2_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dihydrolipoyl dehydrogenase 2, mitochondrial Short name=AtmLPD2 Short name=mtLPD2 EC=1.8.1.4 Alternative name(s): Dihydrolipoamide dehydrogenase 2 Glycine cleavage system L protein 2 Pyruvate dehydrogenase complex E3 subunit 2 Short name=E3-2 Short name=PDC-E3 2 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 507 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Lipoamide dehydrogenase is a component of the glycine decarboxylase (GDC) or glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes. LPD1 is probably the protein most often associated with the glycine decarboxylase complex while LPD2 is probably incorporated into alpha-ketoacid dehydrogenase complexes. Ref.1 Ref.10 |
| Catalytic activity | Protein N(6)-(dihydrolipoyl)lysine + NAD+ = protein N(6)-(lipoyl)lysine + NADH. |
| Cofactor | Binds 1 FAD per subunit By similarity. |
| Subunit structure | Homodimer By similarity. Part of both the glycine cleavage system composed of four proteins: P, T, L and H and of the pyruvate dehydrogenase complex containing multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). |
| Subcellular location | |
| Tissue specificity | Preferentially expressed in roots, flowers and siliques and at a lower level in stems and leaves. Ref.1 |
| Post-translational modification | S-nytrosylated at unknown positions. |
| Disruption phenotype | No visible phenotype, probably due to redundancy with LPD1. |
| Miscellaneous | The active site is a redox-active disulfide bond. |
| Sequence similarities | Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9M5K2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9M5K2-2) The sequence of this isoform differs from the canonical sequence as follows: 92-127: ALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQ → VILETPFPITLIRRKFSPIFIRLLWNLLVDHHLDSI 128-507: Missing. | ||||||
| Note: May be due to an intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 36 | 36 | Mitochondrion Potential | ||||||||
| Chain | 37 – 507 | 471 | Dihydrolipoyl dehydrogenase 2, mitochondrial | PRO_0000260230 | |||||||
Regions | |||||||||||
| Nucleotide binding | 73 – 82 | 10 | FAD By similarity | ||||||||
| Nucleotide binding | 184 – 186 | 3 | FAD By similarity | ||||||||
| Nucleotide binding | 221 – 228 | 8 | NAD By similarity | ||||||||
| Nucleotide binding | 360 – 363 | 4 | FAD By similarity | ||||||||
Sites | |||||||||||
| Active site | 486 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 91 | 1 | FAD By similarity | ||||||||
| Binding site | 155 | 1 | FAD; via amide nitrogen and carbonyl oxygen By similarity | ||||||||
| Binding site | 244 | 1 | NAD By similarity | ||||||||
| Binding site | 278 | 1 | NAD; via amide nitrogen and carbonyl oxygen By similarity | ||||||||
| Binding site | 313 | 1 | NAD; via amide nitrogen By similarity | ||||||||
| Binding site | 354 | 1 | FAD By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 372 | 1 | S-nitrosocysteine | ||||||||
| Disulfide bond | 82 ↔ 87 | Redox-active By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 92 – 127 | 36 | ALLHS…AMLAQ → VILETPFPITLIRRKFSPIF IRLLWNLLVDHHLDSI in isoform 2. | VSP_021588 | |||||||
| Alternative sequence | 128 – 507 | 380 | Missing in isoform 2. | VSP_021589 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of two cDNAs encoding mitochondrial lipoamide dehydrogenase from Arabidopsis." Lutziger I., Oliver D.J. Plant Physiol. 127:615-623(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [2] | "Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones." Sato S., Nakamura Y., Kaneko T., Katoh T., Asamizu E., Tabata S. DNA Res. 7:131-135(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [4] | "Arabidopsis ORF clones." Shinn P., Chen H., Kim C.J., Ecker J.R. Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: cv. Columbia. |
| [5] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Cloning and characterization of 2-oxoglutarate dehydrogenase from Arabidopsis thaliana." Machuy N., Klein M., Mueller-Roeber B. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 36-507 (ISOFORM 1). Strain: cv. Columbia. |
| [7] | "The glycine decarboxylase system: a fascinating complex." Douce R., Bourguignon J., Neuburger M., Rebeille F. Trends Plant Sci. 6:167-176(2001) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [8] | "Genetic manipulation of glycine decarboxylation." Bauwe H., Kolukisaoglu U. J. Exp. Bot. 54:1523-1535(2003) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW, NOMENCLATURE. |
| [9] | "Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins." Heazlewood J.L., Tonti-Filippini J.S., Gout A.M., Day D.A., Whelan J., Millar A.H. Plant Cell 16:241-256(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Strain: cv. Landsberg erecta. |
| [10] | "Lipoic acid-dependent oxidative catabolism of alpha-keto acids in mitochondria provides evidence for branched-chain amino acid catabolism in Arabidopsis." Taylor N.L., Heazlewood J.L., Day D.A., Millar A.H. Plant Physiol. 134:838-848(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Regulation of plant glycine decarboxylase by s-nitrosylation and glutathionylation." Palmieri M.C., Lindermayr C., Bauwe H., Steinhauser C., Durner J. Plant Physiol. 152:1514-1528(2010) [PubMed] [Europe PMC] [Abstract] Cited for: S-NITROSYLATION. |
| [12] | "Proteomics investigation of endogenous S-nitrosylation in Arabidopsis." Fares A., Rossignol M., Peltier J.B. Biochem. Biophys. Res. Commun. 416:331-336(2011) [PubMed] [Europe PMC] [Abstract] Cited for: S-NITROSYLATION AT CYS-372. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF228640 mRNA. Translation: AAF34796.1. AB022216 Genomic DNA. No translation available. CP002686 Genomic DNA. Translation: AEE75925.1. CP002686 Genomic DNA. Translation: AEE75926.1. CP002686 Genomic DNA. Translation: AEE75927.1. BT024578 mRNA. Translation: ABD38917.1. AY087203 mRNA. Translation: AAM64759.1. AJ223804 mRNA. Translation: CAA11554.1. |
| IPI | IPI00519283. IPI00522612. |
| RefSeq | NP_566570.3. NM_112601.3. NP_566571.1. NM_112602.1. NP_851005.1. NM_180674.3. |
| UniGene | At.20793. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1DXL based on UniProtKB P31023. |
| ProteinModelPortal | Q9M5K2. |
| SMR | Q9M5K2. Positions 41-507. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9M5K2. 1 interaction. |
| STRING | 3702.AT3G17240.3-P. |
Proteomic databases | |
| PaxDb | Q9M5K2. |
| PRIDE | Q9M5K2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT3G17240.1; AT3G17240.1; AT3G17240. AT3G17240.3; AT3G17240.3; AT3G17240. |
| GeneID | 820984. |
| KEGG | ath:AT3G17240. |
Organism-specific databases | |
| GeneFarm | 4375. 442. |
| TAIR | At3g17240. |
Phylogenomic databases | |
| eggNOG | COG1249. |
| HOGENOM | HOG000276708. |
| InParanoid | Q9M5K2. |
| KO | K00382. |
| OMA | TIMEAEL. |
| PhylomeDB | Q9M5K2. |
| ProtClustDB | CLSN2682168. |
Gene expression databases | |
| Genevestigator | Q9M5K2. |
| GermOnline | AT3G17240. Arabidopsis thaliana. |
Family and domain databases | |
| Gene3D | 3.30.390.30. 1 hit. |
| InterPro | IPR016156. FAD/NAD-linked_Rdtase_dimer. IPR013027. FAD_pyr_nucl-diS_OxRdtase. IPR006258. Lipoamide_DH. IPR004099. Pyr_nucl-diS_OxRdtase_dimer. IPR023753. Pyr_nucl-diS_OxRdtase_FAD/NAD. IPR012999. Pyr_OxRdtase_I_AS. IPR001327. Pyr_OxRdtase_NAD-bd_dom. [Graphical view] |
| PANTHER | PTHR22912:SF20. PTHR22912:SF20. 1 hit. |
| Pfam | PF00070. Pyr_redox. 1 hit. PF07992. Pyr_redox_2. 1 hit. PF02852. Pyr_redox_dim. 1 hit. [Graphical view] |
| PRINTS | PR00368. FADPNR. |
| SUPFAM | SSF55424. FAD/NAD-linked_reductase_dimer. 1 hit. |
| TIGRFAMs | TIGR01350. lipoamide_DH. 1 hit. |
| PROSITE | PS00076. PYRIDINE_REDOX_1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | DLDH2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9M5K2 Secondary accession number(s): Q8LBH6, Q9ZRQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
